BLASTX nr result
ID: Rehmannia32_contig00007425
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00007425 (344 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB65692.1| Rad23 Protein, partial [Solanum lycopersicum var... 97 3e-24 ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [M... 98 4e-24 gb|PKI60474.1| hypothetical protein CRG98_019128 [Punica granatum] 97 5e-24 ref|XP_022890872.1| ubiquitin receptor RAD23d-like [Olea europae... 97 3e-23 ref|XP_021637909.1| ubiquitin receptor RAD23d-like isoform X2 [H... 98 3e-23 ref|XP_021637908.1| ubiquitin receptor RAD23c-like isoform X1 [H... 98 4e-23 ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [N... 97 1e-22 gb|KHF98435.1| Putative DNA repair RAD23-4 -like protein [Gossyp... 92 1e-22 ref|XP_021675363.1| ubiquitin receptor RAD23c-like [Hevea brasil... 100 1e-22 ref|XP_021634606.1| ubiquitin receptor RAD23c [Manihot esculenta... 100 1e-22 ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [N... 100 1e-22 ref|XP_021604319.1| ubiquitin receptor RAD23d-like isoform X4 [M... 100 2e-22 ref|XP_021604317.1| ubiquitin receptor RAD23d-like isoform X3 [M... 100 2e-22 ref|XP_020547636.1| ubiquitin receptor RAD23c-like [Sesamum indi... 100 2e-22 ref|XP_021604316.1| ubiquitin receptor RAD23d-like isoform X2 [M... 100 2e-22 ref|XP_021604315.1| ubiquitin receptor RAD23d-like isoform X1 [M... 100 2e-22 ref|XP_016474759.1| PREDICTED: ubiquitin receptor RAD23d-like [N... 97 2e-22 gb|KHF97937.1| Putative DNA repair RAD23-4 -like protein [Gossyp... 92 3e-22 dbj|GAV75661.1| ubiquitin domain-containing protein/UBA domain-c... 99 3e-22 gb|OAY31304.1| hypothetical protein MANES_14G101300 [Manihot esc... 98 4e-22 >emb|CAB65692.1| Rad23 Protein, partial [Solanum lycopersicum var. cerasiforme] Length = 65 Score = 97.1 bits (240), Expect = 3e-24 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEV+FACNKNEEL ANYLLDH+HEF+E Sbjct: 17 VTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHLHEFDE 65 >ref|XP_008368492.1| PREDICTED: ubiquitin receptor RAD23d-like [Malus domestica] Length = 111 Score = 97.8 bits (242), Expect = 4e-24 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEV+FACNKNEEL ANYLLDH+HEFEE Sbjct: 63 VTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFEE 111 >gb|PKI60474.1| hypothetical protein CRG98_019128 [Punica granatum] Length = 88 Score = 97.1 bits (240), Expect = 5e-24 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRA+VLEVFFACNKNEEL ANYLLDH+HEFE+ Sbjct: 40 VTPEEREAIERLEAMGFDRAIVLEVFFACNKNEELAANYLLDHMHEFED 88 >ref|XP_022890872.1| ubiquitin receptor RAD23d-like [Olea europaea var. sylvestris] Length = 136 Score = 96.7 bits (239), Expect = 3e-23 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVL+VFFACNKNEEL ANYLLDH+HEF+E Sbjct: 88 VTPEEREAIERLEAMGFDRALVLQVFFACNKNEELAANYLLDHMHEFDE 136 >ref|XP_021637909.1| ubiquitin receptor RAD23d-like isoform X2 [Hevea brasiliensis] Length = 176 Score = 97.8 bits (242), Expect = 3e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDH+HEFE+ Sbjct: 128 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED 176 >ref|XP_021637908.1| ubiquitin receptor RAD23c-like isoform X1 [Hevea brasiliensis] Length = 199 Score = 97.8 bits (242), Expect = 4e-23 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDH+HEFE+ Sbjct: 151 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED 199 >ref|XP_009622421.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tomentosiformis] Length = 194 Score = 96.7 bits (239), Expect = 1e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEV+FACNKNEEL ANYLLDH+HEF+E Sbjct: 146 VTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDE 194 >gb|KHF98435.1| Putative DNA repair RAD23-4 -like protein [Gossypium arboreum] Length = 55 Score = 92.4 bits (228), Expect = 1e-22 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRA VL+VFFACNKNEEL ANYLLDH+H+F++ Sbjct: 7 VTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD 55 >ref|XP_021675363.1| ubiquitin receptor RAD23c-like [Hevea brasiliensis] Length = 382 Score = 100 bits (248), Expect = 1e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 334 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 382 >ref|XP_021634606.1| ubiquitin receptor RAD23c [Manihot esculenta] gb|OAY60403.1| hypothetical protein MANES_01G109600 [Manihot esculenta] Length = 382 Score = 100 bits (248), Expect = 1e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 334 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 382 >ref|XP_010265160.1| PREDICTED: ubiquitin receptor RAD23c-like [Nelumbo nucifera] Length = 383 Score = 100 bits (248), Expect = 1e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 335 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 383 >ref|XP_021604319.1| ubiquitin receptor RAD23d-like isoform X4 [Manihot esculenta] gb|OAY57066.1| hypothetical protein MANES_02G067800 [Manihot esculenta] Length = 399 Score = 100 bits (248), Expect = 2e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 351 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 399 >ref|XP_021604317.1| ubiquitin receptor RAD23d-like isoform X3 [Manihot esculenta] Length = 400 Score = 100 bits (248), Expect = 2e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 352 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 400 >ref|XP_020547636.1| ubiquitin receptor RAD23c-like [Sesamum indicum] Length = 403 Score = 100 bits (248), Expect = 2e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 355 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 403 >ref|XP_021604316.1| ubiquitin receptor RAD23d-like isoform X2 [Manihot esculenta] Length = 414 Score = 100 bits (248), Expect = 2e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 366 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 414 >ref|XP_021604315.1| ubiquitin receptor RAD23d-like isoform X1 [Manihot esculenta] Length = 415 Score = 100 bits (248), Expect = 2e-22 Identities = 48/49 (97%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFEE Sbjct: 367 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFEE 415 >ref|XP_016474759.1| PREDICTED: ubiquitin receptor RAD23d-like [Nicotiana tabacum] Length = 220 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEV+FACNKNEEL ANYLLDH+HEF+E Sbjct: 172 VTPEEREAIERLEAMGFDRALVLEVYFACNKNEELAANYLLDHMHEFDE 220 >gb|KHF97937.1| Putative DNA repair RAD23-4 -like protein [Gossypium arboreum] Length = 88 Score = 92.4 bits (228), Expect = 3e-22 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRA VL+VFFACNKNEEL ANYLLDH+H+F++ Sbjct: 40 VTPEEREAIERLEAMGFDRATVLQVFFACNKNEELAANYLLDHMHDFQD 88 >dbj|GAV75661.1| ubiquitin domain-containing protein/UBA domain-containing protein/XPC-binding domain-containing protein [Cephalotus follicularis] Length = 377 Score = 99.0 bits (245), Expect = 3e-22 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDHIHEFE+ Sbjct: 329 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHIHEFED 377 >gb|OAY31304.1| hypothetical protein MANES_14G101300 [Manihot esculenta] Length = 304 Score = 97.8 bits (242), Expect = 4e-22 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -1 Query: 344 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELTANYLLDHIHEFEE 198 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEEL ANYLLDH+HEFE+ Sbjct: 256 VTPEEREAIERLEAMGFDRALVLEVFFACNKNEELAANYLLDHMHEFED 304