BLASTX nr result
ID: Rehmannia32_contig00007103
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00007103 (904 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV45057.1| hypothetical protein F511_10374 [Dorcoceras hygro... 65 2e-08 gb|AEQ49589.1| reverse transcriptase [Blueberry red ringspot virus] 62 7e-07 gb|AEQ38577.1| reverse transcriptase [Blueberry red ringspot virus] 61 1e-06 gb|AEH95573.1| reverse transcriptase [Blueberry red ringspot virus] 61 1e-06 gb|AEE01492.1| reverse transcriptase [Blueberry red ringspot virus] 61 1e-06 gb|AGT41978.1| reverse transcriptase [Dahlia mosaic virus] 60 2e-06 ref|NP_395469.1| putative reverse transcriptase [Blueberry red r... 60 2e-06 ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 60 3e-06 >gb|KZV45057.1| hypothetical protein F511_10374 [Dorcoceras hygrometricum] Length = 245 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/72 (47%), Positives = 46/72 (63%), Gaps = 2/72 (2%) Frame = -3 Query: 293 VKEGELNLRPQI--GKSKVQTDEIKISPMQVYQRQWEKLVTRQGINPEKTMVDISGKYPR 120 ++E E+NLRPQ GK+KV T+EI ISP + R + + Q N VDISGKY R Sbjct: 65 IEEEEINLRPQTDKGKTKVDTNEIVISPFRFINRSGK--IEIQDRNSVTCRVDISGKYTR 122 Query: 119 VWMKPGSHPNEV 84 +WM+P +HP +V Sbjct: 123 IWMRPNAHPKDV 134 >gb|AEQ49589.1| reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/72 (41%), Positives = 43/72 (59%) Frame = -3 Query: 902 KAFKKWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKS 723 + F+KW + LL+K F LK D+ V FL+ KI++ + RL+RWQ E ++Y IK Sbjct: 582 QTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIKANYNQGRLIRWQLELSQFNYRTFYIKG 641 Query: 722 HENILADFLTRD 687 EN D LTR+ Sbjct: 642 SENYGPDTLTRE 653 >gb|AEQ38577.1| reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 61.2 bits (147), Expect = 1e-06 Identities = 30/72 (41%), Positives = 42/72 (58%) Frame = -3 Query: 902 KAFKKWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKS 723 + F+KW + LL+K F LK D+ V FL+ KI++ + RL+RWQ E + Y IK Sbjct: 582 QTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIKANYNQGRLIRWQLELSQFSYRTFYIKG 641 Query: 722 HENILADFLTRD 687 EN D LTR+ Sbjct: 642 SENYGPDTLTRE 653 >gb|AEH95573.1| reverse transcriptase [Blueberry red ringspot virus] Length = 667 Score = 61.2 bits (147), Expect = 1e-06 Identities = 30/72 (41%), Positives = 42/72 (58%) Frame = -3 Query: 902 KAFKKWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKS 723 + F+KW + LL+K F LK D+ V FL+ KI++ + RL+RWQ E + Y IK Sbjct: 592 QTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIKANYNQGRLIRWQLELSQFSYRTFYIKG 651 Query: 722 HENILADFLTRD 687 EN D LTR+ Sbjct: 652 SENYGPDTLTRE 663 >gb|AEE01492.1| reverse transcriptase [Blueberry red ringspot virus] Length = 680 Score = 61.2 bits (147), Expect = 1e-06 Identities = 30/72 (41%), Positives = 42/72 (58%) Frame = -3 Query: 902 KAFKKWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKS 723 + F+KW + LL K F LK D+ V FL+ KI++ + RL+RWQ E ++Y IK Sbjct: 605 QTFRKWKVDLLTKPFILKTDSKYVTGFLRYKIKANYNQGRLIRWQLELSQFNYRTFYIKG 664 Query: 722 HENILADFLTRD 687 EN D LTR+ Sbjct: 665 SENYGPDTLTRE 676 >gb|AGT41978.1| reverse transcriptase [Dahlia mosaic virus] Length = 825 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/68 (41%), Positives = 43/68 (63%) Frame = -3 Query: 890 KWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKSHENI 711 K+ ++L+ KF ++ DN + FLK KI ++ RL+RWQ Y +DI ++ +N+ Sbjct: 751 KFSIYLIPVKFLVRTDNRNFTYFLKTKISGDNKQGRLVRWQMWFSRYSFDIEHLEGPKNV 810 Query: 710 LADFLTRD 687 LADFLTRD Sbjct: 811 LADFLTRD 818 >ref|NP_395469.1| putative reverse transcriptase [Blueberry red ringspot virus] gb|AAL13274.1|AF404509_4 putative reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 60.1 bits (144), Expect = 2e-06 Identities = 29/72 (40%), Positives = 42/72 (58%) Frame = -3 Query: 902 KAFKKWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKS 723 + F+KW + LL+K F LK D+ V FL+ KI++ + R +RWQ E ++Y IK Sbjct: 582 QTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIKANYNQGRFIRWQLELSQFNYRTFYIKG 641 Query: 722 HENILADFLTRD 687 EN D LTR+ Sbjct: 642 SENYGPDTLTRE 653 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 59.7 bits (143), Expect = 3e-06 Identities = 29/72 (40%), Positives = 43/72 (59%) Frame = -3 Query: 902 KAFKKWPLFLLAKKFTLKIDNSSVKAFLKNKIESKPEKARLLRWQAECQYYDYDIVIIKS 723 K +KW LL K+FTL+ D+S V F ++ +++ + RL+RWQ E Y + IK Sbjct: 568 KTMRKWKAELLPKEFTLRTDSSYVTGFARHNLKANYNQGRLVRWQLEFLQYPARVEYIKG 627 Query: 722 HENILADFLTRD 687 +N LAD LTR+ Sbjct: 628 EKNSLADTLTRE 639