BLASTX nr result
ID: Rehmannia32_contig00006829
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00006829 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18248.1| hypothetical protein CDL12_09076 [Handroanthus im... 69 1e-12 ref|XP_011079860.1| ribosome-recycling factor, chloroplastic [Se... 68 5e-11 gb|PKI60552.1| hypothetical protein CRG98_019028 [Punica granatum] 67 5e-11 ref|XP_019188417.1| PREDICTED: ribosome-recycling factor, chloro... 68 5e-11 ref|XP_021987477.1| ribosome-recycling factor, chloroplastic [He... 68 7e-11 ref|XP_010255993.1| PREDICTED: ribosome-recycling factor, chloro... 68 8e-11 gb|KHG13016.1| Ribosome-recycling factor, chloroplastic [Gossypi... 67 1e-10 emb|CDP03634.1| unnamed protein product [Coffea canephora] 67 1e-10 gb|KJB42103.1| hypothetical protein B456_007G137300 [Gossypium r... 65 1e-10 gb|PPS12847.1| hypothetical protein GOBAR_AA07800 [Gossypium bar... 67 2e-10 gb|KHG13015.1| Ribosome-recycling factor, chloroplastic [Gossypi... 67 2e-10 ref|XP_022865900.1| ribosome-recycling factor, chloroplastic [Ol... 67 2e-10 ref|XP_020519755.1| ribosome-recycling factor, chloroplastic iso... 65 2e-10 ref|XP_017631492.1| PREDICTED: ribosome-recycling factor, chloro... 67 2e-10 ref|XP_016710530.1| PREDICTED: ribosome-recycling factor, chloro... 67 2e-10 gb|OWM77866.1| hypothetical protein CDL15_Pgr018435 [Punica gran... 67 2e-10 gb|ABK26242.1| unknown [Picea sitchensis] 65 3e-10 gb|KVH94406.1| Ribosome recycling factor [Cynara cardunculus var... 65 3e-10 ref|XP_012490571.1| PREDICTED: ribosome-recycling factor, chloro... 65 5e-10 ref|XP_017969561.1| PREDICTED: ribosome-recycling factor, chloro... 65 5e-10 >gb|PIN18248.1| hypothetical protein CDL12_09076 [Handroanthus impetiginosus] Length = 110 Score = 69.3 bits (168), Expect = 1e-12 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLSADLQKVTDEYMKKIDSIYKQKEK+L+TV Sbjct: 76 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKELLTV 110 >ref|XP_011079860.1| ribosome-recycling factor, chloroplastic [Sesamum indicum] Length = 265 Score = 68.2 bits (165), Expect = 5e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQKVTDEYMKKIDSIYKQKEK+L+TV Sbjct: 231 DNVKDLSSDLQKVTDEYMKKIDSIYKQKEKELLTV 265 >gb|PKI60552.1| hypothetical protein CRG98_019028 [Punica granatum] Length = 173 Score = 66.6 bits (161), Expect = 5e-11 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 139 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 173 >ref|XP_019188417.1| PREDICTED: ribosome-recycling factor, chloroplastic [Ipomoea nil] Length = 273 Score = 68.2 bits (165), Expect = 5e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQKVTDEYMKKIDSIYKQKEK+L+TV Sbjct: 239 DNVKDLSSDLQKVTDEYMKKIDSIYKQKEKELLTV 273 >ref|XP_021987477.1| ribosome-recycling factor, chloroplastic [Helianthus annuus] gb|OTG09975.1| putative ribosome-recycling factor protein [Helianthus annuus] Length = 265 Score = 67.8 bits (164), Expect = 7e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLSADLQKVTDEYMKKIDSI+KQKEK+L+TV Sbjct: 231 DNVKDLSADLQKVTDEYMKKIDSIFKQKEKELLTV 265 >ref|XP_010255993.1| PREDICTED: ribosome-recycling factor, chloroplastic [Nelumbo nucifera] Length = 280 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQKVTDEYMKKIDS+YKQKEK+L+TV Sbjct: 246 DNVKDLSSDLQKVTDEYMKKIDSVYKQKEKELLTV 280 >gb|KHG13016.1| Ribosome-recycling factor, chloroplastic [Gossypium arboreum] Length = 218 Score = 66.6 bits (161), Expect = 1e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 184 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 218 >emb|CDP03634.1| unnamed protein product [Coffea canephora] Length = 311 Score = 67.4 bits (163), Expect = 1e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQKVTDEYMKKIDS+YKQKEK+L+TV Sbjct: 277 DNVKDLSSDLQKVTDEYMKKIDSLYKQKEKELLTV 311 >gb|KJB42103.1| hypothetical protein B456_007G137300 [Gossypium raimondii] Length = 178 Score = 65.5 bits (158), Expect = 1e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKID IYKQKEK+L+TV Sbjct: 144 DNVKDLSSDLQKLTDEYMKKIDGIYKQKEKELLTV 178 >gb|PPS12847.1| hypothetical protein GOBAR_AA07800 [Gossypium barbadense] Length = 254 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 220 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 254 >gb|KHG13015.1| Ribosome-recycling factor, chloroplastic [Gossypium arboreum] Length = 254 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 220 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 254 >ref|XP_022865900.1| ribosome-recycling factor, chloroplastic [Olea europaea var. sylvestris] Length = 265 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQKVTDEYMKKIDSI+KQKEK+L+TV Sbjct: 231 DNVKDLSSDLQKVTDEYMKKIDSIFKQKEKELLTV 265 >ref|XP_020519755.1| ribosome-recycling factor, chloroplastic isoform X3 [Amborella trichopoda] Length = 173 Score = 65.1 bits (157), Expect = 2e-10 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQKVTD Y+KKIDSIYKQKEK+LMTV Sbjct: 139 DNVKDLSSDLQKVTDGYVKKIDSIYKQKEKELMTV 173 >ref|XP_017631492.1| PREDICTED: ribosome-recycling factor, chloroplastic [Gossypium arboreum] Length = 276 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 242 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 276 >ref|XP_016710530.1| PREDICTED: ribosome-recycling factor, chloroplastic-like [Gossypium hirsutum] Length = 276 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 242 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 276 >gb|OWM77866.1| hypothetical protein CDL15_Pgr018435 [Punica granatum] Length = 277 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDS+YKQKEK+L+TV Sbjct: 243 DNVKDLSSDLQKLTDEYMKKIDSVYKQKEKELLTV 277 >gb|ABK26242.1| unknown [Picea sitchensis] Length = 173 Score = 64.7 bits (156), Expect = 3e-10 Identities = 29/35 (82%), Positives = 34/35 (97%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS DLQKVTDE++KK+DS+YKQKEK+LMTV Sbjct: 139 DNVKDLSGDLQKVTDEFIKKVDSLYKQKEKELMTV 173 >gb|KVH94406.1| Ribosome recycling factor [Cynara cardunculus var. scolymus] Length = 196 Score = 65.1 bits (157), Expect = 3e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS DLQKVTDEYMKKID+I+KQKEK+L+TV Sbjct: 162 DNVKDLSVDLQKVTDEYMKKIDTIFKQKEKELLTV 196 >ref|XP_012490571.1| PREDICTED: ribosome-recycling factor, chloroplastic isoform X1 [Gossypium raimondii] ref|XP_012490572.1| PREDICTED: ribosome-recycling factor, chloroplastic isoform X2 [Gossypium raimondii] ref|XP_016696109.1| PREDICTED: ribosome-recycling factor, chloroplastic-like [Gossypium hirsutum] gb|KJB42101.1| hypothetical protein B456_007G137300 [Gossypium raimondii] Length = 276 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKID IYKQKEK+L+TV Sbjct: 242 DNVKDLSSDLQKLTDEYMKKIDGIYKQKEKELLTV 276 >ref|XP_017969561.1| PREDICTED: ribosome-recycling factor, chloroplastic isoform X3 [Theobroma cacao] gb|EOX94754.1| Ribosome recycling factor isoform 1 [Theobroma cacao] Length = 277 Score = 65.5 bits (158), Expect = 5e-10 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 48 DNVKDLSADLQKVTDEYMKKIDSIYKQKEKDLMTV 152 DNVKDLS+DLQK+TDEYMKKIDSI+KQKEK+L+TV Sbjct: 243 DNVKDLSSDLQKLTDEYMKKIDSIFKQKEKELLTV 277