BLASTX nr result
ID: Rehmannia32_contig00006512
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00006512 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP08886.1| unnamed protein product [Coffea canephora] 82 1e-15 gb|PKI45390.1| hypothetical protein CRG98_034195 [Punica granatum] 80 5e-15 ref|XP_009761323.1| PREDICTED: peroxisomal membrane protein 11D-... 79 1e-14 ref|XP_016748241.1| PREDICTED: peroxisomal membrane protein 11C ... 79 1e-14 ref|XP_017630693.1| PREDICTED: peroxisomal membrane protein 11C ... 79 1e-14 gb|PIN16247.1| Peroxisomal biogenesis protein (peroxin) [Handroa... 79 1e-14 ref|XP_011035325.1| PREDICTED: peroxisomal membrane protein 11D ... 78 3e-14 ref|XP_002320762.1| peroxisomal biogenesis factor 11 family prot... 78 3e-14 ref|XP_022770355.1| peroxisomal membrane protein 11D isoform X2 ... 74 5e-14 gb|OMO78671.1| Peroxisomal biogenesis factor 11 [Corchorus capsu... 77 5e-14 ref|XP_016695454.1| PREDICTED: peroxisomal membrane protein 11C-... 77 5e-14 ref|XP_015055388.1| PREDICTED: peroxisomal membrane protein 11D ... 77 5e-14 ref|XP_012489865.1| PREDICTED: peroxisomal membrane protein 11C ... 77 5e-14 ref|XP_011093177.1| peroxisomal membrane protein 11C [Sesamum in... 77 7e-14 ref|XP_011091593.1| peroxisomal membrane protein 11C [Sesamum in... 77 7e-14 ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C ... 77 7e-14 ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11D ... 77 7e-14 ref|XP_009598453.1| PREDICTED: peroxisomal membrane protein 11D ... 76 1e-13 gb|OMP00522.1| Peroxisomal biogenesis factor 11 [Corchorus olito... 76 1e-13 ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Popu... 75 1e-13 >emb|CDP08886.1| unnamed protein product [Coffea canephora] Length = 235 Score = 81.6 bits (200), Expect = 1e-15 Identities = 46/66 (69%), Positives = 48/66 (72%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KLQKSNER+LAL+KAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 QYRVKLQKSNERSLALIKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPS 228 Query: 190 PQKAKT 207 PQKAKT Sbjct: 229 PQKAKT 234 >gb|PKI45390.1| hypothetical protein CRG98_034195 [Punica granatum] Length = 235 Score = 79.7 bits (195), Expect = 5e-15 Identities = 45/67 (67%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KL+KSNERTLAL+KAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 QYRAKLRKSNERTLALIKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAKTT 210 P KAKT+ Sbjct: 229 PPKAKTS 235 >ref|XP_009761323.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana sylvestris] ref|XP_009761324.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana sylvestris] ref|XP_016448412.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana tabacum] ref|XP_016448419.1| PREDICTED: peroxisomal membrane protein 11D-like [Nicotiana tabacum] Length = 234 Score = 79.0 bits (193), Expect = 1e-14 Identities = 44/67 (65%), Positives = 49/67 (73%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR+KLQKSNER+LAL+KAGMDIVVAVGLLQL SLISCYQLLP+ Sbjct: 168 QYRSKLQKSNERSLALIKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVTSLISCYQLLPA 227 Query: 190 PQKAKTT 210 P KAKT+ Sbjct: 228 PAKAKTS 234 >ref|XP_016748241.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium hirsutum] ref|XP_016748242.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium hirsutum] ref|XP_016748243.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium hirsutum] ref|XP_016748244.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium hirsutum] ref|XP_016748245.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium hirsutum] Length = 235 Score = 79.0 bits (193), Expect = 1e-14 Identities = 45/66 (68%), Positives = 47/66 (71%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 +YR KLQKSNERTLALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 EYRAKLQKSNERTLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAKT 207 P K+KT Sbjct: 229 PPKSKT 234 >ref|XP_017630693.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630694.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630696.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630697.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630698.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630699.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630700.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630701.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] ref|XP_017630702.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium arboreum] Length = 236 Score = 79.0 bits (193), Expect = 1e-14 Identities = 45/66 (68%), Positives = 47/66 (71%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 +YR KLQKSNERTLALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 170 EYRAKLQKSNERTLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 229 Query: 190 PQKAKT 207 P K+KT Sbjct: 230 PPKSKT 235 >gb|PIN16247.1| Peroxisomal biogenesis protein (peroxin) [Handroanthus impetiginosus] Length = 235 Score = 78.6 bits (192), Expect = 1e-14 Identities = 44/67 (65%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR+KLQKSNER++ALVKAGMD+VVAVGLLQL SLISCYQLLPS Sbjct: 169 QYRSKLQKSNERSVALVKAGMDLVVAVGLLQLAPKKITPRVTGAFGFASSLISCYQLLPS 228 Query: 190 PQKAKTT 210 P K KTT Sbjct: 229 PPKTKTT 235 >ref|XP_011035325.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] ref|XP_011035333.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] ref|XP_011035337.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] ref|XP_011035345.1| PREDICTED: peroxisomal membrane protein 11D [Populus euphratica] Length = 235 Score = 77.8 bits (190), Expect = 3e-14 Identities = 44/67 (65%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KL+KSNER+LALVK+ MDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAKTT 210 PQK+KTT Sbjct: 229 PQKSKTT 235 >ref|XP_002320762.1| peroxisomal biogenesis factor 11 family protein [Populus trichocarpa] ref|XP_006375324.1| hypothetical protein POPTR_0014s07250g [Populus trichocarpa] gb|ABK96573.1| unknown [Populus trichocarpa x Populus deltoides] gb|PNT03556.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] gb|PNT03557.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] gb|PNT03558.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] gb|PNT03559.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] gb|PNT03561.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] gb|PNT03562.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] gb|PNT03563.1| hypothetical protein POPTR_014G076400v3 [Populus trichocarpa] Length = 235 Score = 77.8 bits (190), Expect = 3e-14 Identities = 44/67 (65%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KL+KSNER+LALVK+ MDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGGFGFVSSLISCYQLLPS 228 Query: 190 PQKAKTT 210 PQK+KTT Sbjct: 229 PQKSKTT 235 >ref|XP_022770355.1| peroxisomal membrane protein 11D isoform X2 [Durio zibethinus] Length = 105 Score = 73.9 bits (180), Expect = 5e-14 Identities = 42/66 (63%), Positives = 46/66 (69%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 ++R KLQKSNERTLALVKA MDIVVAVGLLQL S+ISCYQLLPS Sbjct: 39 EFRAKLQKSNERTLALVKAAMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSVISCYQLLPS 98 Query: 190 PQKAKT 207 P K+KT Sbjct: 99 PPKSKT 104 >gb|OMO78671.1| Peroxisomal biogenesis factor 11 [Corchorus capsularis] Length = 235 Score = 77.0 bits (188), Expect = 5e-14 Identities = 44/65 (67%), Positives = 46/65 (70%), Gaps = 16/65 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 +YR KLQKSNERTLALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 EYRAKLQKSNERTLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAK 204 P K+K Sbjct: 229 PPKSK 233 >ref|XP_016695454.1| PREDICTED: peroxisomal membrane protein 11C-like [Gossypium hirsutum] ref|XP_016695455.1| PREDICTED: peroxisomal membrane protein 11C-like [Gossypium hirsutum] ref|XP_016695456.1| PREDICTED: peroxisomal membrane protein 11C-like [Gossypium hirsutum] ref|XP_016695457.1| PREDICTED: peroxisomal membrane protein 11C-like [Gossypium hirsutum] ref|XP_016695458.1| PREDICTED: peroxisomal membrane protein 11C-like [Gossypium hirsutum] gb|PPD90058.1| hypothetical protein GOBAR_DD12995 [Gossypium barbadense] gb|PPR81296.1| hypothetical protein GOBAR_AA39415 [Gossypium barbadense] Length = 235 Score = 77.0 bits (188), Expect = 5e-14 Identities = 44/66 (66%), Positives = 46/66 (69%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 +YR KLQ SNERTLALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 EYRAKLQNSNERTLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAKT 207 P K+KT Sbjct: 229 PPKSKT 234 >ref|XP_015055388.1| PREDICTED: peroxisomal membrane protein 11D [Solanum pennellii] ref|XP_015055394.1| PREDICTED: peroxisomal membrane protein 11D [Solanum pennellii] Length = 235 Score = 77.0 bits (188), Expect = 5e-14 Identities = 43/67 (64%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KLQKSNER+LAL+KAG+DIVVAVGLLQL SLISCYQLLP+ Sbjct: 169 QYRVKLQKSNERSLALIKAGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPA 228 Query: 190 PQKAKTT 210 P KAKT+ Sbjct: 229 PPKAKTS 235 >ref|XP_012489865.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium raimondii] ref|XP_012489866.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium raimondii] ref|XP_012489867.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium raimondii] ref|XP_012489868.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium raimondii] ref|XP_012489869.1| PREDICTED: peroxisomal membrane protein 11C [Gossypium raimondii] gb|KJB41216.1| hypothetical protein B456_007G095300 [Gossypium raimondii] gb|KJB41217.1| hypothetical protein B456_007G095300 [Gossypium raimondii] gb|KJB41218.1| hypothetical protein B456_007G095300 [Gossypium raimondii] gb|KJB41219.1| hypothetical protein B456_007G095300 [Gossypium raimondii] Length = 235 Score = 77.0 bits (188), Expect = 5e-14 Identities = 44/66 (66%), Positives = 46/66 (69%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 +YR KLQ SNERTLALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 EYRAKLQNSNERTLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAKT 207 P K+KT Sbjct: 229 PPKSKT 234 >ref|XP_011093177.1| peroxisomal membrane protein 11C [Sesamum indicum] Length = 235 Score = 76.6 bits (187), Expect = 7e-14 Identities = 43/67 (64%), Positives = 47/67 (70%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR+KLQKSNER++ L+KA MDIVVAVG LQL SLISCYQLLPS Sbjct: 169 QYRSKLQKSNERSVDLIKAAMDIVVAVGFLQLAPKKVTPRVIGAFGFATSLISCYQLLPS 228 Query: 190 PQKAKTT 210 PQKAKTT Sbjct: 229 PQKAKTT 235 >ref|XP_011091593.1| peroxisomal membrane protein 11C [Sesamum indicum] ref|XP_011091600.1| peroxisomal membrane protein 11C [Sesamum indicum] ref|XP_011091609.1| peroxisomal membrane protein 11C [Sesamum indicum] Length = 235 Score = 76.6 bits (187), Expect = 7e-14 Identities = 44/65 (67%), Positives = 47/65 (72%), Gaps = 16/65 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR+KL+KSNER+LALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 QYRSKLKKSNERSLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAK 204 P KAK Sbjct: 229 PTKAK 233 >ref|XP_006339470.1| PREDICTED: peroxisomal membrane protein 11C [Solanum tuberosum] ref|XP_006339471.1| PREDICTED: peroxisomal membrane protein 11C [Solanum tuberosum] Length = 235 Score = 76.6 bits (187), Expect = 7e-14 Identities = 43/67 (64%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KLQKSNER+LAL+KAG+DIVVAVGLLQL SLISCYQLLP+ Sbjct: 169 QYRIKLQKSNERSLALIKAGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPA 228 Query: 190 PQKAKTT 210 P KAKT+ Sbjct: 229 PPKAKTS 235 >ref|XP_004229845.1| PREDICTED: peroxisomal membrane protein 11D [Solanum lycopersicum] ref|XP_004229846.1| PREDICTED: peroxisomal membrane protein 11D [Solanum lycopersicum] Length = 235 Score = 76.6 bits (187), Expect = 7e-14 Identities = 43/67 (64%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KLQKSNER+LAL+KAG+DIVVAVGLLQL SLISCYQLLP+ Sbjct: 169 QYRIKLQKSNERSLALIKAGIDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPA 228 Query: 190 PQKAKTT 210 P KAKT+ Sbjct: 229 PPKAKTS 235 >ref|XP_009598453.1| PREDICTED: peroxisomal membrane protein 11D [Nicotiana tomentosiformis] ref|XP_009598454.1| PREDICTED: peroxisomal membrane protein 11D [Nicotiana tomentosiformis] ref|XP_016458168.1| PREDICTED: peroxisomal membrane protein 11D [Nicotiana tabacum] ref|XP_016458169.1| PREDICTED: peroxisomal membrane protein 11D [Nicotiana tabacum] Length = 234 Score = 76.3 bits (186), Expect = 1e-13 Identities = 42/67 (62%), Positives = 48/67 (71%), Gaps = 16/67 (23%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR+KLQ+SNER+LAL+KAGMDIVVA GLLQL SLISCYQLLP+ Sbjct: 168 QYRSKLQRSNERSLALIKAGMDIVVAAGLLQLAPKKVTPRVTGAFGFITSLISCYQLLPA 227 Query: 190 PQKAKTT 210 P KAKT+ Sbjct: 228 PAKAKTS 234 >gb|OMP00522.1| Peroxisomal biogenesis factor 11 [Corchorus olitorius] Length = 235 Score = 76.3 bits (186), Expect = 1e-13 Identities = 44/65 (67%), Positives = 46/65 (70%), Gaps = 16/65 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 +YR KLQKSNERTLALVKAGMDIVVAVGLLQL SLISCYQLLPS Sbjct: 169 EYRGKLQKSNERTLALVKAGMDIVVAVGLLQLAPKKVTPRVTGAFGFVSSLISCYQLLPS 228 Query: 190 PQKAK 204 P K+K Sbjct: 229 PPKSK 233 >ref|XP_006386590.1| hypothetical protein POPTR_0002s15510g [Populus trichocarpa] gb|PNT49844.1| hypothetical protein POPTR_002G153800v3 [Populus trichocarpa] Length = 180 Score = 75.1 bits (183), Expect = 1e-13 Identities = 43/66 (65%), Positives = 46/66 (69%), Gaps = 16/66 (24%) Frame = +1 Query: 58 QYRTKLQKSNERTLALVKAGMDIVVAVGLLQL----------------XSLISCYQLLPS 189 QYR KL+KSNER+LALVK+ MDIVVAVGLLQL SLISCYQLLPS Sbjct: 114 QYRAKLKKSNERSLALVKSAMDIVVAVGLLQLAPKKVTPRVTGAFGVVTSLISCYQLLPS 173 Query: 190 PQKAKT 207 PQK KT Sbjct: 174 PQKPKT 179