BLASTX nr result
ID: Rehmannia32_contig00005715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00005715 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR34506.1| hypothetical protein CICLE_v10006402mg [Citrus cl... 57 6e-08 gb|PIN18306.1| hypothetical protein CDL12_09010 [Handroanthus im... 54 8e-07 gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus cl... 53 3e-06 >gb|ESR34506.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 46 Score = 57.0 bits (136), Expect = 6e-08 Identities = 26/33 (78%), Positives = 28/33 (84%), Gaps = 1/33 (3%) Frame = -1 Query: 297 AGYPTENPPTGK-KKKGLPRTKAKGDRGFLEGW 202 AGYPTENPP GK KKK L +TK KGDRGF+EGW Sbjct: 14 AGYPTENPPAGKGKKKCLSQTKKKGDRGFIEGW 46 >gb|PIN18306.1| hypothetical protein CDL12_09010 [Handroanthus impetiginosus] Length = 58 Score = 54.3 bits (129), Expect = 8e-07 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 2/32 (6%) Frame = -1 Query: 294 GYPTENPPTGKKKKGL--PRTKAKGDRGFLEG 205 GYPTENPPTG KKK PRTKAKG+RGFLEG Sbjct: 11 GYPTENPPTGNKKKMKCWPRTKAKGERGFLEG 42 >gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/32 (78%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = -1 Query: 297 AGYPTENPPTGK-KKKGLPRTKAKGDRGFLEG 205 AGYPTENPP GK KKK L +TK KGDRGF+EG Sbjct: 14 AGYPTENPPAGKGKKKCLSQTKKKGDRGFIEG 45