BLASTX nr result
ID: Rehmannia32_contig00004647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00004647 (418 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099948.1| protein RSI-1 [Sesamum indicum] 77 7e-16 gb|PIN02838.1| hypothetical protein CDL12_24645 [Handroanthus im... 76 2e-15 ref|XP_015057126.1| PREDICTED: protein RSI-1 [Solanum pennellii] 75 8e-15 ref|XP_021972531.1| protein RSI-1-like [Helianthus annuus] >gi|1... 75 8e-15 ref|XP_019231770.1| PREDICTED: protein RSI-1 [Nicotiana attenuat... 74 2e-14 ref|XP_009802479.1| PREDICTED: protein RSI-1 [Nicotiana sylvestr... 74 2e-14 ref|XP_009615077.1| PREDICTED: protein RSI-1 [Nicotiana tomentos... 74 2e-14 ref|XP_019177143.1| PREDICTED: protein RSI-1-like [Ipomoea nil] 74 2e-14 gb|PHT99705.1| Protein RSI-1, partial [Capsicum chinense] 74 2e-14 ref|XP_016572505.1| PREDICTED: protein RSI-1 [Capsicum annuum] >... 74 2e-14 ref|XP_006364638.1| PREDICTED: protein RSI-1 [Solanum tuberosum] 74 2e-14 emb|CDP01621.1| unnamed protein product [Coffea canephora] 74 2e-14 ref|XP_022009997.1| protein RSI-1-like [Helianthus annuus] >gi|1... 73 3e-14 ref|XP_022895434.1| protein RSI-1-like [Olea europaea var. sylve... 73 4e-14 ref|NP_001234666.1| protein RSI-1 precursor [Solanum lycopersicu... 72 6e-14 ref|XP_012844988.1| PREDICTED: protein RSI-1-like [Erythranthe g... 72 7e-14 ref|XP_023735561.1| protein RSI-1-like [Lactuca sativa] 72 9e-14 ref|XP_023735572.1| protein RSI-1-like [Lactuca sativa] >gi|1322... 71 2e-13 gb|PHT25728.1| Protein RSI-1, partial [Capsicum baccatum] 71 2e-13 gb|ONI17483.1| hypothetical protein PRUPE_3G161500 [Prunus persica] 71 2e-13 >ref|XP_011099948.1| protein RSI-1 [Sesamum indicum] Length = 94 Score = 77.4 bits (189), Expect = 7e-16 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYNHLRP++C+PRCTYRCSATSHKKPCMFFCLK Sbjct: 27 GYNHLRPQECRPRCTYRCSATSHKKPCMFFCLK 59 >gb|PIN02838.1| hypothetical protein CDL12_24645 [Handroanthus impetiginosus] Length = 97 Score = 76.3 bits (186), Expect = 2e-15 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN+LRP+DC+PRCTYRCSATSHKKPCMFFCLK Sbjct: 30 GYNNLRPQDCRPRCTYRCSATSHKKPCMFFCLK 62 >ref|XP_015057126.1| PREDICTED: protein RSI-1 [Solanum pennellii] Length = 96 Score = 74.7 bits (182), Expect = 8e-15 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRPRDC+PRCTYRCSATSHKKPCMFFC K Sbjct: 29 GYNKLRPRDCKPRCTYRCSATSHKKPCMFFCQK 61 >ref|XP_021972531.1| protein RSI-1-like [Helianthus annuus] gb|OTG20068.1| putative gibberellin regulated protein [Helianthus annuus] Length = 97 Score = 74.7 bits (182), Expect = 8e-15 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRPRDC+PRCTYRCSATSHKKPCMFFC K Sbjct: 30 GYNKLRPRDCKPRCTYRCSATSHKKPCMFFCQK 62 >ref|XP_019231770.1| PREDICTED: protein RSI-1 [Nicotiana attenuata] gb|OIT28502.1| protein rsi-1 [Nicotiana attenuata] Length = 96 Score = 73.9 bits (180), Expect = 2e-14 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN+L+PRDC+PRCTYRCSATSHKKPCMFFC K Sbjct: 29 GYNNLQPRDCKPRCTYRCSATSHKKPCMFFCQK 61 >ref|XP_009802479.1| PREDICTED: protein RSI-1 [Nicotiana sylvestris] ref|XP_016474318.1| PREDICTED: protein RSI-1 [Nicotiana tabacum] Length = 96 Score = 73.9 bits (180), Expect = 2e-14 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN+L+PRDC+PRCTYRCSATSHKKPCMFFC K Sbjct: 29 GYNNLQPRDCKPRCTYRCSATSHKKPCMFFCQK 61 >ref|XP_009615077.1| PREDICTED: protein RSI-1 [Nicotiana tomentosiformis] ref|XP_016463473.1| PREDICTED: protein RSI-1-like [Nicotiana tabacum] Length = 96 Score = 73.9 bits (180), Expect = 2e-14 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN+L+PRDC+PRCTYRCSATSHKKPCMFFC K Sbjct: 29 GYNNLQPRDCKPRCTYRCSATSHKKPCMFFCQK 61 >ref|XP_019177143.1| PREDICTED: protein RSI-1-like [Ipomoea nil] Length = 97 Score = 73.9 bits (180), Expect = 2e-14 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP+DC+PRCTYRCSATSHKKPCMFFC K Sbjct: 30 GYNRLRPKDCKPRCTYRCSATSHKKPCMFFCQK 62 >gb|PHT99705.1| Protein RSI-1, partial [Capsicum chinense] Length = 89 Score = 73.6 bits (179), Expect = 2e-14 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRPRDC+PRCTYRCSATSH+KPCMFFC K Sbjct: 29 GYNKLRPRDCKPRCTYRCSATSHRKPCMFFCQK 61 >ref|XP_016572505.1| PREDICTED: protein RSI-1 [Capsicum annuum] gb|PHT64695.1| Gibberellin-regulated protein 12 [Capsicum annuum] Length = 96 Score = 73.6 bits (179), Expect = 2e-14 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRPRDC+PRCTYRCSATSH+KPCMFFC K Sbjct: 29 GYNKLRPRDCKPRCTYRCSATSHRKPCMFFCQK 61 >ref|XP_006364638.1| PREDICTED: protein RSI-1 [Solanum tuberosum] Length = 96 Score = 73.6 bits (179), Expect = 2e-14 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRPRDC+P+CTYRCSATSHKKPCMFFC K Sbjct: 29 GYNKLRPRDCKPKCTYRCSATSHKKPCMFFCQK 61 >emb|CDP01621.1| unnamed protein product [Coffea canephora] Length = 98 Score = 73.6 bits (179), Expect = 2e-14 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN L PRDC PRCTYRCS TSHKKPCMFFCLK Sbjct: 31 GYNRLHPRDCSPRCTYRCSGTSHKKPCMFFCLK 63 >ref|XP_022009997.1| protein RSI-1-like [Helianthus annuus] gb|OTF98357.1| putative protein RSI-1 [Helianthus annuus] Length = 93 Score = 73.2 bits (178), Expect = 3e-14 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP+DC+PRCTYRCSATSHKKPCMFFC K Sbjct: 26 GYNKLRPQDCKPRCTYRCSATSHKKPCMFFCQK 58 >ref|XP_022895434.1| protein RSI-1-like [Olea europaea var. sylvestris] Length = 95 Score = 72.8 bits (177), Expect = 4e-14 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN L PRDC PRCTYRCSATSHKKPCMFFC K Sbjct: 28 GYNRLHPRDCNPRCTYRCSATSHKKPCMFFCQK 60 >ref|NP_001234666.1| protein RSI-1 precursor [Solanum lycopersicum] sp|P47926.1|RSI1_SOLLC RecName: Full=Protein RSI-1; AltName: Full=TR132; Flags: Precursor gb|AAA20129.1| RSI-1 protein [Solanum lycopersicum] gb|AAA20130.1| RSI-1 protein [Solanum lycopersicum] Length = 96 Score = 72.4 bits (176), Expect = 6e-14 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP DC+PRCTYRCSATSHKKPCMFFC K Sbjct: 29 GYNKLRPTDCKPRCTYRCSATSHKKPCMFFCQK 61 >ref|XP_012844988.1| PREDICTED: protein RSI-1-like [Erythranthe guttata] gb|EYU30907.1| hypothetical protein MIMGU_mgv1a017014mg [Erythranthe guttata] Length = 97 Score = 72.4 bits (176), Expect = 7e-14 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP+DC+PRCTYRCSATSHKKPCM +CLK Sbjct: 30 GYNRLRPQDCKPRCTYRCSATSHKKPCMLYCLK 62 >ref|XP_023735561.1| protein RSI-1-like [Lactuca sativa] Length = 96 Score = 72.0 bits (175), Expect = 9e-14 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP+DC+P+CTYRCSATSHKKPCMFFC K Sbjct: 29 GYNKLRPQDCKPKCTYRCSATSHKKPCMFFCQK 61 >ref|XP_023735572.1| protein RSI-1-like [Lactuca sativa] gb|PLY72535.1| hypothetical protein LSAT_2X69401 [Lactuca sativa] Length = 96 Score = 71.2 bits (173), Expect = 2e-13 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GY LRPRDC+P+CTYRCSATSHKKPCMFFC K Sbjct: 29 GYKKLRPRDCKPKCTYRCSATSHKKPCMFFCQK 61 >gb|PHT25728.1| Protein RSI-1, partial [Capsicum baccatum] Length = 89 Score = 70.9 bits (172), Expect = 2e-13 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP DC+PRCTYRCSATSH+KPCMFFC K Sbjct: 29 GYNKLRPGDCKPRCTYRCSATSHRKPCMFFCQK 61 >gb|ONI17483.1| hypothetical protein PRUPE_3G161500 [Prunus persica] Length = 89 Score = 70.9 bits (172), Expect = 2e-13 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 318 GYNHLRPRDCQPRCTYRCSATSHKKPCMFFCLK 416 GYN LRP +C+PRCTYRCSATSHKKPCMFFC K Sbjct: 22 GYNKLRPSECKPRCTYRCSATSHKKPCMFFCQK 54