BLASTX nr result
ID: Rehmannia32_contig00004590
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00004590 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098243.1| multiple organellar RNA editing factor 8, ch... 62 3e-08 ref|XP_021288480.1| multiple organellar RNA editing factor 8, ch... 53 8e-06 >ref|XP_011098243.1| multiple organellar RNA editing factor 8, chloroplastic/mitochondrial [Sesamum indicum] Length = 440 Score = 62.4 bits (150), Expect = 3e-08 Identities = 34/62 (54%), Positives = 37/62 (59%), Gaps = 3/62 (4%) Frame = -1 Query: 187 NNMRAPPGNNAPNHQYGPGPNNG---YQSXXXXXXXXXXXXXXPSQGQNQNAYAPNMGGG 17 NNMR PP NNAPN+QYG G N+G YQS P QGQNQ+ Y PNMGGG Sbjct: 298 NNMRGPP-NNAPNYQYGHGNNSGGAPYQSGPGPNQNGFAPSMVPGQGQNQSGYGPNMGGG 356 Query: 16 NP 11 P Sbjct: 357 FP 358 >ref|XP_021288480.1| multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like, partial [Herrania umbratica] Length = 127 Score = 52.8 bits (125), Expect = 8e-06 Identities = 21/21 (100%), Positives = 21/21 (100%) Frame = -1 Query: 481 GEPFINGQAVPYDPKYHEEWV 419 GEPFINGQAVPYDPKYHEEWV Sbjct: 50 GEPFINGQAVPYDPKYHEEWV 70