BLASTX nr result
ID: Rehmannia32_contig00003567
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003567 (590 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PKH63240.1| hypothetical protein CRG98_050261 [Punica granatum] 54 2e-06 >gb|PKH63240.1| hypothetical protein CRG98_050261 [Punica granatum] Length = 92 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 101 RKMDLRLLYGLVFLSFSTTCFLCLHLILQPVFYFTS 208 R M LR++YGLVFLSFS CF LHL L+PVFY TS Sbjct: 57 RPMALRIVYGLVFLSFSCACFKILHLFLRPVFYLTS 92