BLASTX nr result
ID: Rehmannia32_contig00003381
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003381 (473 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN01074.1| hypothetical protein CDL12_26419 [Handroanthus im... 70 8e-13 ref|XP_011076629.1| wound-induced protein 1 [Sesamum indicum] 70 2e-12 gb|PIN26167.1| hypothetical protein CDL12_01085 [Handroanthus im... 69 2e-12 ref|XP_012858782.1| PREDICTED: wound-induced protein 1 [Erythran... 63 8e-10 gb|KZV34928.1| wound-induced protein 1 [Dorcoceras hygrometricum] 62 3e-09 sp|P20144.1|WUN1_SOLTU RecName: Full=Wound-induced protein 1 60 8e-09 ref|XP_022887158.1| wound-induced protein 1-like [Olea europaea ... 62 9e-09 ref|XP_022845571.1| wound-induced protein 1 [Olea europaea var. ... 60 1e-08 gb|PHT44945.1| Wound-induced protein 1 [Capsicum baccatum] >gi|1... 60 1e-08 ref|XP_017220428.1| PREDICTED: wound-induced protein 1 [Daucus c... 59 2e-08 ref|XP_010322279.1| PREDICTED: wound-induced protein 1 [Solanum ... 60 2e-08 ref|XP_019192197.1| PREDICTED: wound-induced protein 1 [Ipomoea ... 59 2e-08 ref|XP_015078443.1| PREDICTED: wound-induced protein 1 [Solanum ... 60 3e-08 ref|XP_006353404.1| PREDICTED: wound-induced protein 1 [Solanum ... 59 3e-08 ref|XP_015077615.1| PREDICTED: wound-induced protein 1-like [Sol... 59 3e-08 ref|XP_004240897.1| PREDICTED: wound-induced protein 1-like [Sol... 59 3e-08 ref|XP_016576617.1| PREDICTED: wound-induced protein 1-like, par... 60 6e-08 gb|PHU13958.1| Wound-induced protein 1 [Capsicum chinense] 60 9e-08 ref|XP_024030106.1| wound-induced protein 1 [Morus notabilis] 58 9e-08 gb|OIT27646.1| wound-induced protein 1 [Nicotiana attenuata] 57 9e-08 >gb|PIN01074.1| hypothetical protein CDL12_26419 [Handroanthus impetiginosus] Length = 107 Score = 70.5 bits (171), Expect = 8e-13 Identities = 35/38 (92%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = +1 Query: 1 DQSDCS-SSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 DQSDCS SSI LHCPSVWESSLPDRVGKSVPGLVLAI Sbjct: 70 DQSDCSTSSIVPLHCPSVWESSLPDRVGKSVPGLVLAI 107 >ref|XP_011076629.1| wound-induced protein 1 [Sesamum indicum] Length = 108 Score = 69.7 bits (169), Expect = 2e-12 Identities = 35/39 (89%), Positives = 37/39 (94%), Gaps = 2/39 (5%) Frame = +1 Query: 1 DQSDCS--SSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 DQSDC+ SSIASL+CPSVWESSLPDRVGKSVPGLVLAI Sbjct: 70 DQSDCTTTSSIASLNCPSVWESSLPDRVGKSVPGLVLAI 108 >gb|PIN26167.1| hypothetical protein CDL12_01085 [Handroanthus impetiginosus] Length = 104 Score = 69.3 bits (168), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +1 Query: 1 DQSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 DQSDCS IASLHCPSVW+SSLPDRVGKSVPGLVLAI Sbjct: 70 DQSDCS--IASLHCPSVWQSSLPDRVGKSVPGLVLAI 104 >ref|XP_012858782.1| PREDICTED: wound-induced protein 1 [Erythranthe guttata] Length = 110 Score = 62.8 bits (151), Expect = 8e-10 Identities = 31/41 (75%), Positives = 34/41 (82%), Gaps = 6/41 (14%) Frame = +1 Query: 7 SDCSSS------IASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SDC+++ I SLHCPSVWESSLPDRVGKSVPGLVLAI Sbjct: 70 SDCTTTTTTTTGIVSLHCPSVWESSLPDRVGKSVPGLVLAI 110 >gb|KZV34928.1| wound-induced protein 1 [Dorcoceras hygrometricum] Length = 161 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 25 IASLHCPSVWESSLPDRVGKSVPGLVLAI 111 IASLHCPSVWESSLPDRVGKSVPGLVLAI Sbjct: 133 IASLHCPSVWESSLPDRVGKSVPGLVLAI 161 >sp|P20144.1|WUN1_SOLTU RecName: Full=Wound-induced protein 1 Length = 105 Score = 60.1 bits (144), Expect = 8e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 19 SSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SSI +LHCPSVWESSLP+RVGKSVPGLVLA+ Sbjct: 75 SSITTLHCPSVWESSLPNRVGKSVPGLVLAL 105 >ref|XP_022887158.1| wound-induced protein 1-like [Olea europaea var. sylvestris] Length = 199 Score = 62.0 bits (149), Expect = 9e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 DQSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 D+SD SS I SLHCPS+WESSLP+RVGKSVPGLVLAI Sbjct: 164 DKSDYSS-ITSLHCPSLWESSLPNRVGKSVPGLVLAI 199 >ref|XP_022845571.1| wound-induced protein 1 [Olea europaea var. sylvestris] Length = 108 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 19 SSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 S+I SLHCPS+WESSLP+RVGKSVPGLVLAI Sbjct: 78 SNITSLHCPSLWESSLPNRVGKSVPGLVLAI 108 >gb|PHT44945.1| Wound-induced protein 1 [Capsicum baccatum] gb|PHT78256.1| Wound-induced protein 1 [Capsicum annuum] Length = 109 Score = 59.7 bits (143), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 4 QSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 QSD SS LHCPSVWESSLP+RVGKS PGLVLA+ Sbjct: 74 QSDISSITPPLHCPSVWESSLPNRVGKSFPGLVLAL 109 >ref|XP_017220428.1| PREDICTED: wound-induced protein 1 [Daucus carota subsp. sativus] gb|KZM84023.1| hypothetical protein DCAR_028555 [Daucus carota subsp. sativus] Length = 108 Score = 59.3 bits (142), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 7 SDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SD SS + SLHCPS+WESS+ +RVGKSVPGLVLAI Sbjct: 74 SDFSSKVTSLHCPSLWESSVSNRVGKSVPGLVLAI 108 >ref|XP_010322279.1| PREDICTED: wound-induced protein 1 [Solanum lycopersicum] Length = 161 Score = 60.5 bits (145), Expect = 2e-08 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 1 DQSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 +QSD SS I LHCPSVWESSLP+RVGKSVPGLVLA+ Sbjct: 126 NQSDISS-ITPLHCPSVWESSLPNRVGKSVPGLVLAL 161 >ref|XP_019192197.1| PREDICTED: wound-induced protein 1 [Ipomoea nil] Length = 108 Score = 58.9 bits (141), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 7 SDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 S +++I LHCPSVWESSLP+RVGKSVPGLVLAI Sbjct: 74 SAAAAAITPLHCPSVWESSLPNRVGKSVPGLVLAI 108 >ref|XP_015078443.1| PREDICTED: wound-induced protein 1 [Solanum pennellii] Length = 161 Score = 60.1 bits (144), Expect = 3e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 4 QSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 QSD SS I LHCPSVWESSLP+RVGKSVPGLVLA+ Sbjct: 127 QSDISS-ITPLHCPSVWESSLPNRVGKSVPGLVLAL 161 >ref|XP_006353404.1| PREDICTED: wound-induced protein 1 [Solanum tuberosum] Length = 112 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +1 Query: 7 SDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SD SS S HCPS+WESSLP+RVGKSVPGLVLA+ Sbjct: 78 SDLSSIAPSRHCPSIWESSLPNRVGKSVPGLVLAL 112 >ref|XP_015077615.1| PREDICTED: wound-induced protein 1-like [Solanum pennellii] Length = 114 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 7 SDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SD SS A+ HCPS+WESSLP+RVGKSVPGLVLA+ Sbjct: 80 SDLSSIAATRHCPSLWESSLPNRVGKSVPGLVLAL 114 >ref|XP_004240897.1| PREDICTED: wound-induced protein 1-like [Solanum lycopersicum] Length = 115 Score = 58.9 bits (141), Expect = 3e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 7 SDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SD SS A+ HCPS+WESSLP+RVGKSVPGLVLA+ Sbjct: 81 SDLSSIAATRHCPSLWESSLPNRVGKSVPGLVLAL 115 >ref|XP_016576617.1| PREDICTED: wound-induced protein 1-like, partial [Capsicum annuum] Length = 195 Score = 59.7 bits (143), Expect = 6e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 4 QSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 QSD SS LHCPSVWESSLP+RVGKS PGLVLA+ Sbjct: 160 QSDISSITPPLHCPSVWESSLPNRVGKSFPGLVLAL 195 >gb|PHU13958.1| Wound-induced protein 1 [Capsicum chinense] Length = 223 Score = 59.7 bits (143), Expect = 9e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 4 QSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 QSD SS LHCPSVWESSLP+RVGKS PGLVLA+ Sbjct: 188 QSDISSITPPLHCPSVWESSLPNRVGKSFPGLVLAL 223 >ref|XP_024030106.1| wound-induced protein 1 [Morus notabilis] Length = 122 Score = 57.8 bits (138), Expect = 9e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +1 Query: 1 DQSDCSSSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 + S ++ IAS HCPSVWESSL +RVGKSVPGLVLAI Sbjct: 86 NSSSSTAEIASYHCPSVWESSLSNRVGKSVPGLVLAI 122 >gb|OIT27646.1| wound-induced protein 1 [Nicotiana attenuata] Length = 108 Score = 57.4 bits (137), Expect = 9e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 19 SSIASLHCPSVWESSLPDRVGKSVPGLVLAI 111 SSIA HCPS+WESSLP+RVGKSVPGLVLA+ Sbjct: 78 SSIAPRHCPSLWESSLPNRVGKSVPGLVLAL 108