BLASTX nr result
ID: Rehmannia32_contig00003294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003294 (807 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022724331.1| protein PYRICULARIA ORYZAE RESISTANCE 21-lik... 75 1e-12 ref|XP_022724329.1| protein PYRICULARIA ORYZAE RESISTANCE 21-lik... 75 1e-12 ref|XP_022716247.1| protein PYRICULARIA ORYZAE RESISTANCE 21 iso... 75 2e-12 ref|XP_022716246.1| protein PYRICULARIA ORYZAE RESISTANCE 21 iso... 75 2e-12 emb|CDP21271.1| unnamed protein product [Coffea canephora] 72 3e-12 emb|CDO99450.1| unnamed protein product [Coffea canephora] 72 3e-12 ref|XP_019223786.1| PREDICTED: neurofilament medium polypeptide-... 75 3e-12 emb|CDP04521.1| unnamed protein product [Coffea canephora] 72 5e-12 emb|CDP04524.1| unnamed protein product [Coffea canephora] 71 5e-12 ref|XP_012841611.1| PREDICTED: pollen-specific leucine-rich repe... 74 8e-12 gb|EYU33837.1| hypothetical protein MIMGU_mgv1a027133mg [Erythra... 74 9e-12 ref|XP_011095916.1| pollen-specific leucine-rich repeat extensin... 74 1e-11 ref|XP_016447112.1| PREDICTED: pollen-specific leucine-rich repe... 74 1e-11 ref|XP_009613311.1| PREDICTED: pollen-specific leucine-rich repe... 74 1e-11 ref|XP_009801191.1| PREDICTED: pollen-specific leucine-rich repe... 73 2e-11 gb|PPD91063.1| hypothetical protein GOBAR_DD12014 [Gossypium bar... 71 2e-11 ref|XP_016472798.1| PREDICTED: pollen-specific leucine-rich repe... 73 3e-11 ref|XP_009606116.1| PREDICTED: pollen-specific leucine-rich repe... 73 3e-11 ref|XP_021902389.1| pollen-specific leucine-rich repeat extensin... 72 3e-11 ref|XP_017615797.1| PREDICTED: protein spalten-like [Gossypium a... 72 4e-11 >ref|XP_022724331.1| protein PYRICULARIA ORYZAE RESISTANCE 21-like [Durio zibethinus] Length = 210 Score = 75.5 bits (184), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEKANTVTITVVCCSPEKIRDK+CCKGG Sbjct: 33 IRDQIYDEKANTVTITVVCCSPEKIRDKICCKGG 66 >ref|XP_022724329.1| protein PYRICULARIA ORYZAE RESISTANCE 21-like [Durio zibethinus] ref|XP_022724330.1| protein PYRICULARIA ORYZAE RESISTANCE 21-like [Durio zibethinus] Length = 217 Score = 75.5 bits (184), Expect = 1e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEKANTVTITVVCCSPEKIRDK+CCKGG Sbjct: 33 IRDQIYDEKANTVTITVVCCSPEKIRDKICCKGG 66 >ref|XP_022716247.1| protein PYRICULARIA ORYZAE RESISTANCE 21 isoform X2 [Durio zibethinus] Length = 251 Score = 75.5 bits (184), Expect = 2e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEKANTVTITVVCCSPEKIRDK+CCKGG Sbjct: 26 IRDQIYDEKANTVTITVVCCSPEKIRDKICCKGG 59 >ref|XP_022716246.1| protein PYRICULARIA ORYZAE RESISTANCE 21 isoform X1 [Durio zibethinus] Length = 258 Score = 75.5 bits (184), Expect = 2e-12 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEKANTVTITVVCCSPEKIRDK+CCKGG Sbjct: 33 IRDQIYDEKANTVTITVVCCSPEKIRDKICCKGG 66 >emb|CDP21271.1| unnamed protein product [Coffea canephora] Length = 116 Score = 72.0 bits (175), Expect = 3e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEK N VTITVVCCSPEKIRDKLCCKGG Sbjct: 33 IRDQIYDEKQNLVTITVVCCSPEKIRDKLCCKGG 66 >emb|CDO99450.1| unnamed protein product [Coffea canephora] Length = 105 Score = 71.6 bits (174), Expect = 3e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEK N VTITVVCCSPEKIRDKLCCKGG Sbjct: 33 IRDQVYDEKQNLVTITVVCCSPEKIRDKLCCKGG 66 >ref|XP_019223786.1| PREDICTED: neurofilament medium polypeptide-like [Nicotiana attenuata] gb|OIT05741.1| hypothetical protein A4A49_02284 [Nicotiana attenuata] Length = 276 Score = 75.5 bits (184), Expect = 3e-12 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 +RDQ+YDEKANTVTITVVCCSPEKIRDKLCCKGG Sbjct: 37 VRDQVYDEKANTVTITVVCCSPEKIRDKLCCKGG 70 >emb|CDP04521.1| unnamed protein product [Coffea canephora] Length = 138 Score = 72.0 bits (175), Expect = 5e-12 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEK N VTITVVCCSPEKIRDKLCCKGG Sbjct: 32 IRDQIYDEKQNLVTITVVCCSPEKIRDKLCCKGG 65 >emb|CDP04524.1| unnamed protein product [Coffea canephora] Length = 102 Score = 70.9 bits (172), Expect = 5e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEK N VTITVVCCSPEKIRDKLCCKGG Sbjct: 33 IRDQMYDEKQNLVTITVVCCSPEKIRDKLCCKGG 66 >ref|XP_012841611.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Erythranthe guttata] Length = 236 Score = 73.6 bits (179), Expect = 8e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEKANTVTI VVCCSPEKIRDKLCCKGG Sbjct: 12 IRDQVYDEKANTVTIIVVCCSPEKIRDKLCCKGG 45 >gb|EYU33837.1| hypothetical protein MIMGU_mgv1a027133mg [Erythranthe guttata] Length = 238 Score = 73.6 bits (179), Expect = 9e-12 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEKANTVTI VVCCSPEKIRDKLCCKGG Sbjct: 14 IRDQVYDEKANTVTIIVVCCSPEKIRDKLCCKGG 47 >ref|XP_011095916.1| pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] ref|XP_020554108.1| pollen-specific leucine-rich repeat extensin-like protein 1 [Sesamum indicum] Length = 275 Score = 73.6 bits (179), Expect = 1e-11 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKG 707 IRDQ+YDEKANTVTITVVCCSPEKIRDKLCCKG Sbjct: 33 IRDQVYDEKANTVTITVVCCSPEKIRDKLCCKG 65 >ref|XP_016447112.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana tabacum] Length = 278 Score = 73.6 bits (179), Expect = 1e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 +RDQ+YDEKANTVTITVVCCSPE IRDKLCCKGG Sbjct: 37 VRDQVYDEKANTVTITVVCCSPENIRDKLCCKGG 70 >ref|XP_009613311.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 2 [Nicotiana tomentosiformis] Length = 278 Score = 73.6 bits (179), Expect = 1e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 +RDQ+YDEKANTVTITVVCCSPE IRDKLCCKGG Sbjct: 37 VRDQVYDEKANTVTITVVCCSPENIRDKLCCKGG 70 >ref|XP_009801191.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana sylvestris] ref|XP_016470420.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana tabacum] Length = 293 Score = 73.2 bits (178), Expect = 2e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEKANT+TITV+CC+PEKIRDKLCCKGG Sbjct: 37 IRDQVYDEKANTITITVLCCNPEKIRDKLCCKGG 70 >gb|PPD91063.1| hypothetical protein GOBAR_DD12014 [Gossypium barbadense] Length = 184 Score = 71.2 bits (173), Expect = 2e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKG 707 IRDQIYDEKANTVTITVVCC+PEK+RDK+CCKG Sbjct: 26 IRDQIYDEKANTVTITVVCCNPEKLRDKICCKG 58 >ref|XP_016472798.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana tabacum] Length = 321 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEKANT+TITV+CC+PEKIRDKLCCKGG Sbjct: 37 IRDQVYDEKANTITITVLCCNPEKIRDKLCCKGG 70 >ref|XP_009606116.1| PREDICTED: pollen-specific leucine-rich repeat extensin-like protein 1 [Nicotiana tomentosiformis] Length = 321 Score = 73.2 bits (178), Expect = 3e-11 Identities = 30/34 (88%), Positives = 34/34 (100%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEKANT+TITV+CC+PEKIRDKLCCKGG Sbjct: 37 IRDQVYDEKANTITITVLCCNPEKIRDKLCCKGG 70 >ref|XP_021902389.1| pollen-specific leucine-rich repeat extensin-like protein 1 [Carica papaya] Length = 263 Score = 72.4 bits (176), Expect = 3e-11 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQ+YDEK+NTV ITVVCCSPEKIRDKLCCKGG Sbjct: 33 IRDQVYDEKSNTVRITVVCCSPEKIRDKLCCKGG 66 >ref|XP_017615797.1| PREDICTED: protein spalten-like [Gossypium arboreum] Length = 248 Score = 72.0 bits (175), Expect = 4e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 805 IRDQIYDEKANTVTITVVCCSPEKIRDKLCCKGG 704 IRDQIYDEKANTVTITVVCCSPEKIRDKLC KGG Sbjct: 33 IRDQIYDEKANTVTITVVCCSPEKIRDKLCYKGG 66