BLASTX nr result
ID: Rehmannia32_contig00003073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00003073 (511 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT47222.1| ATP-citrate synthase alpha chain protein 3 [Capsi... 116 1e-30 ref|XP_022159525.1| ATP-citrate synthase alpha chain protein 2 [... 120 3e-29 gb|EXB53826.1| hypothetical protein L484_003261 [Morus notabilis] 114 9e-29 dbj|GAY58826.1| hypothetical protein CUMW_189770 [Citrus unshiu] 113 1e-28 gb|PHT88748.1| hypothetical protein T459_10854 [Capsicum annuum] 111 1e-28 ref|XP_023929891.1| ATP-citrate synthase alpha chain protein 3-l... 118 2e-28 ref|XP_011092193.1| ATP-citrate synthase alpha chain protein 2 [... 118 2e-28 ref|XP_016573512.1| PREDICTED: ATP-citrate synthase alpha chain ... 118 3e-28 gb|PAN21422.1| hypothetical protein PAHAL_I04550 [Panicum hallii] 118 3e-28 gb|OEL30588.1| ATP-citrate synthase alpha chain protein 3 [Dicha... 118 3e-28 ref|XP_004962739.1| ATP-citrate synthase alpha chain protein 3 [... 118 3e-28 ref|XP_023917167.1| ATP-citrate synthase alpha chain protein 2 [... 118 3e-28 ref|XP_023929890.1| ATP-citrate synthase alpha chain protein 2-l... 118 3e-28 ref|XP_023929889.1| ATP-citrate synthase alpha chain protein 2-l... 118 3e-28 ref|XP_023521201.1| ATP-citrate synthase alpha chain protein 2 [... 118 3e-28 ref|XP_022968728.1| ATP-citrate synthase alpha chain protein 2 [... 118 3e-28 ref|XP_022961536.1| ATP-citrate synthase alpha chain protein 2 [... 118 3e-28 gb|PHT41418.1| hypothetical protein CQW23_20272 [Capsicum baccat... 118 3e-28 ref|XP_020102079.1| ATP-citrate synthase alpha chain protein 2 i... 118 3e-28 ref|XP_019237592.1| PREDICTED: ATP-citrate synthase alpha chain ... 118 3e-28 >gb|PHT47222.1| ATP-citrate synthase alpha chain protein 3 [Capsicum baccatum] Length = 116 Score = 116 bits (291), Expect = 1e-30 Identities = 56/65 (86%), Positives = 59/65 (90%), Gaps = 1/65 (1%) Frame = -3 Query: 194 TWKL-VHLFF*VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIE 18 TW + + L VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIE Sbjct: 31 TWFVKIQLGVEVEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIE 90 Query: 17 ENWDK 3 E+WDK Sbjct: 91 ESWDK 95 >ref|XP_022159525.1| ATP-citrate synthase alpha chain protein 2 [Momordica charantia] Length = 423 Score = 120 bits (302), Expect = 3e-29 Identities = 56/60 (93%), Positives = 57/60 (95%) Frame = -3 Query: 182 VHLFF*VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 +HL VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 87 IHLGVQVEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >gb|EXB53826.1| hypothetical protein L484_003261 [Morus notabilis] Length = 191 Score = 114 bits (285), Expect = 9e-29 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLG TISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGSTISFSECGGIEIEENWDK 146 >dbj|GAY58826.1| hypothetical protein CUMW_189770 [Citrus unshiu] Length = 174 Score = 113 bits (283), Expect = 1e-28 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCK PITTFIVEPFVPH+QEYYLSIVS+RLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKGPITTFIVEPFVPHNQEYYLSIVSDRLGCTISFSECGGIEIEENWDK 146 >gb|PHT88748.1| hypothetical protein T459_10854 [Capsicum annuum] Length = 115 Score = 111 bits (278), Expect = 1e-28 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 +EMGGCKAPIT FIVEPFVPHDQEYYLSIVSERLGCTI+FSECGGIEIEE+WDK Sbjct: 45 LEMGGCKAPITIFIVEPFVPHDQEYYLSIVSERLGCTINFSECGGIEIEESWDK 98 >ref|XP_023929891.1| ATP-citrate synthase alpha chain protein 3-like isoform X2 [Quercus suber] Length = 399 Score = 118 bits (295), Expect = 2e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_011092193.1| ATP-citrate synthase alpha chain protein 2 [Sesamum indicum] Length = 415 Score = 118 bits (295), Expect = 2e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_016573512.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 [Capsicum annuum] Length = 418 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 88 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 141 >gb|PAN21422.1| hypothetical protein PAHAL_I04550 [Panicum hallii] Length = 422 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >gb|OEL30588.1| ATP-citrate synthase alpha chain protein 3 [Dichanthelium oligosanthes] Length = 422 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_004962739.1| ATP-citrate synthase alpha chain protein 3 [Setaria italica] ref|XP_004962740.1| ATP-citrate synthase alpha chain protein 3 [Setaria italica] gb|KQL16572.1| hypothetical protein SETIT_022146mg [Setaria italica] gb|KQL16573.1| hypothetical protein SETIT_022146mg [Setaria italica] Length = 422 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_023917167.1| ATP-citrate synthase alpha chain protein 2 [Quercus suber] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_023929890.1| ATP-citrate synthase alpha chain protein 2-like isoform X1 [Quercus suber] gb|POE88919.1| atp-citrate synthase alpha chain protein 2 [Quercus suber] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_023929889.1| ATP-citrate synthase alpha chain protein 2-like [Quercus suber] gb|POE88920.1| atp-citrate synthase alpha chain protein 2 [Quercus suber] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_023521201.1| ATP-citrate synthase alpha chain protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023516548.1| ATP-citrate synthase alpha chain protein 2 isoform X1 [Cucurbita pepo subsp. pepo] ref|XP_023516549.1| ATP-citrate synthase alpha chain protein 2 isoform X2 [Cucurbita pepo subsp. pepo] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_022968728.1| ATP-citrate synthase alpha chain protein 2 [Cucurbita maxima] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_022961536.1| ATP-citrate synthase alpha chain protein 2 [Cucurbita moschata] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >gb|PHT41418.1| hypothetical protein CQW23_20272 [Capsicum baccatum] gb|PHT62240.1| ATP-citrate synthase alpha chain protein 3 [Capsicum annuum] gb|PHT98202.1| ATP-citrate synthase alpha chain protein 3 [Capsicum chinense] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_020102079.1| ATP-citrate synthase alpha chain protein 2 isoform X2 [Ananas comosus] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146 >ref|XP_019237592.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 [Nicotiana attenuata] gb|OIT22302.1| atp-citrate synthase alpha chain protein 3 [Nicotiana attenuata] Length = 423 Score = 118 bits (295), Expect = 3e-28 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -3 Query: 164 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 3 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK Sbjct: 93 VEMGGCKAPITTFIVEPFVPHDQEYYLSIVSERLGCTISFSECGGIEIEENWDK 146