BLASTX nr result
ID: Rehmannia32_contig00002640
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00002640 (398 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO36792.1| hypothetical protein CISIN_1g040105mg, partial [C... 60 1e-09 >gb|KDO36792.1| hypothetical protein CISIN_1g040105mg, partial [Citrus sinensis] Length = 76 Score = 60.5 bits (145), Expect = 1e-09 Identities = 30/50 (60%), Positives = 35/50 (70%) Frame = +2 Query: 2 DCEPSLRRSVVWWCC*GKDH*SFLGGRTKDREEGLEDTESKGKACC*ELK 151 DCE L S+VWW C G+D+ S LGGRT+D EE ED ESKGKA EL+ Sbjct: 2 DCESYLWWSIVWWGCQGEDNSSILGGRTEDCEESFEDPESKGKAGLKELE 51