BLASTX nr result
ID: Rehmannia32_contig00002316
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00002316 (423 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101031.1| uncharacterized protein LOC105179131 [Sesamu... 67 1e-10 gb|PIN21013.1| hypothetical protein CDL12_06296 [Handroanthus im... 57 6e-07 >ref|XP_011101031.1| uncharacterized protein LOC105179131 [Sesamum indicum] Length = 211 Score = 66.6 bits (161), Expect = 1e-10 Identities = 34/57 (59%), Positives = 44/57 (77%), Gaps = 5/57 (8%) Frame = -2 Query: 323 RIKKIV----FKRFDREKEFRVLKKLRKH-RIQNAEEEKKKNGGVMKRVGKFLDHYF 168 R+KKI + RF+REKE +VLKK+RKH R+Q+ E+E++K G MKRV KFLDHYF Sbjct: 155 RMKKIFKRYDYDRFNREKELKVLKKMRKHFRLQHEEKEREKRSGFMKRVRKFLDHYF 211 >gb|PIN21013.1| hypothetical protein CDL12_06296 [Handroanthus impetiginosus] Length = 205 Score = 56.6 bits (135), Expect = 6e-07 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 6/58 (10%) Frame = -2 Query: 323 RIKKIVFKRFD-----REKEFRVLKKLRKH-RIQNAEEEKKKNGGVMKRVGKFLDHYF 168 RIKK VFKRFD +EK+ + LKK+RKH R+QN E+ K GG M+RV KF D++F Sbjct: 151 RIKKAVFKRFDFNRFDKEKKLKALKKMRKHFRLQN---EEAKIGGFMRRVRKFFDYFF 205