BLASTX nr result
ID: Rehmannia32_contig00001941
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00001941 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18974.1| 1,3-beta-glucan synthase/callose synthase catalyt... 73 3e-12 gb|EYU46327.1| hypothetical protein MIMGU_mgv1a000070mg [Erythra... 72 6e-12 ref|XP_012830127.1| PREDICTED: callose synthase 3-like [Erythran... 72 6e-12 ref|XP_011083139.1| callose synthase 3 isoform X2 [Sesamum indicum] 72 6e-12 ref|XP_020550348.1| callose synthase 3 isoform X1 [Sesamum indicum] 72 6e-12 ref|XP_011080223.1| callose synthase 3 [Sesamum indicum] 72 1e-11 ref|XP_022847384.1| callose synthase 3-like [Olea europaea var. ... 69 1e-10 ref|XP_012828960.1| PREDICTED: callose synthase 3 [Erythranthe g... 65 2e-09 emb|CDP11070.1| unnamed protein product [Coffea canephora] 64 7e-09 gb|EPS70715.1| hypothetical protein M569_04038, partial [Genlise... 60 1e-07 dbj|GAU12088.1| hypothetical protein TSUD_00540 [Trifolium subte... 60 1e-07 dbj|GAU12087.1| hypothetical protein TSUD_00530 [Trifolium subte... 60 2e-07 gb|PNY17494.1| callose synthase 3-like protein [Trifolium pratense] 59 2e-07 ref|XP_022154081.1| callose synthase 3 isoform X2 [Momordica cha... 59 2e-07 ref|XP_022154079.1| callose synthase 3 isoform X1 [Momordica cha... 59 2e-07 ref|XP_021821428.1| callose synthase 3 [Prunus avium] >gi|122006... 59 4e-07 ref|XP_020420986.1| callose synthase 3 [Prunus persica] >gi|1162... 59 4e-07 ref|XP_008243622.1| PREDICTED: callose synthase 3 [Prunus mume] ... 59 4e-07 ref|XP_023531977.1| callose synthase 3-like [Cucurbita pepo subs... 58 7e-07 ref|XP_022966525.1| callose synthase 3-like [Cucurbita maxima] >... 58 7e-07 >gb|PIN18974.1| 1,3-beta-glucan synthase/callose synthase catalytic subunit [Handroanthus impetiginosus] Length = 1948 Score = 73.2 bits (178), Expect = 3e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSS GGPSQQNPQLQRRITRTQTVGNLGES+FDSEVV Sbjct: 1 MSSSGGPSQQNPQLQRRITRTQTVGNLGESVFDSEVV 37 >gb|EYU46327.1| hypothetical protein MIMGU_mgv1a000070mg [Erythranthe guttata] Length = 1935 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRG PSQQNPQLQRRITRTQTVGNLGESIFDSEVV Sbjct: 1 MSSRGVPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 37 >ref|XP_012830127.1| PREDICTED: callose synthase 3-like [Erythranthe guttata] ref|XP_012830135.1| PREDICTED: callose synthase 3-like [Erythranthe guttata] Length = 1948 Score = 72.4 bits (176), Expect = 6e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRG PSQQNPQLQRRITRTQTVGNLGESIFDSEVV Sbjct: 1 MSSRGVPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 37 >ref|XP_011083139.1| callose synthase 3 isoform X2 [Sesamum indicum] Length = 1948 Score = 72.4 bits (176), Expect = 6e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG SQQNPQLQRRITRTQTVGNLGES+FDSEVV Sbjct: 1 MSSRGGQSQQNPQLQRRITRTQTVGNLGESVFDSEVV 37 >ref|XP_020550348.1| callose synthase 3 isoform X1 [Sesamum indicum] Length = 1950 Score = 72.4 bits (176), Expect = 6e-12 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG SQQNPQLQRRITRTQTVGNLGES+FDSEVV Sbjct: 1 MSSRGGQSQQNPQLQRRITRTQTVGNLGESVFDSEVV 37 >ref|XP_011080223.1| callose synthase 3 [Sesamum indicum] Length = 1948 Score = 71.6 bits (174), Expect = 1e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG +QQNPQLQRRITRTQTVGNLGESIFDSEVV Sbjct: 1 MSSRGGSTQQNPQLQRRITRTQTVGNLGESIFDSEVV 37 >ref|XP_022847384.1| callose synthase 3-like [Olea europaea var. sylvestris] ref|XP_022847385.1| callose synthase 3-like [Olea europaea var. sylvestris] Length = 1944 Score = 68.6 bits (166), Expect = 1e-10 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 M SRGG S QNPQLQRRITRTQTVGNLGESIFDSEVV Sbjct: 1 MLSRGGSSHQNPQLQRRITRTQTVGNLGESIFDSEVV 37 >ref|XP_012828960.1| PREDICTED: callose synthase 3 [Erythranthe guttata] ref|XP_012828961.1| PREDICTED: callose synthase 3 [Erythranthe guttata] gb|EYU17999.1| hypothetical protein MIMGU_mgv1a000067mg [Erythranthe guttata] Length = 1948 Score = 65.5 bits (158), Expect = 2e-09 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGGPSQQN L RRI RTQTVGNLGES+FDSEVV Sbjct: 1 MSSRGGPSQQNQPLPRRIPRTQTVGNLGESVFDSEVV 37 >emb|CDP11070.1| unnamed protein product [Coffea canephora] Length = 1946 Score = 63.5 bits (153), Expect = 7e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG S Q P LQRR+TRTQTVGNLGE++FDSEVV Sbjct: 1 MSSRGGSSTQQPPLQRRLTRTQTVGNLGETVFDSEVV 37 >gb|EPS70715.1| hypothetical protein M569_04038, partial [Genlisea aurea] Length = 1941 Score = 60.1 bits (144), Expect = 1e-07 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 340 SQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 SQQNPQLQRR+TRTQTVGN+GESIFDSEVV Sbjct: 1 SQQNPQLQRRLTRTQTVGNIGESIFDSEVV 30 >dbj|GAU12088.1| hypothetical protein TSUD_00540 [Trifolium subterraneum] Length = 544 Score = 59.7 bits (143), Expect = 1e-07 Identities = 31/38 (81%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +1 Query: 319 MSSRGGPSQ-QNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSR GPS+ Q P LQRRITRTQT GNLGE+IFDSEVV Sbjct: 1 MSSRPGPSESQGPPLQRRITRTQTAGNLGEAIFDSEVV 38 >dbj|GAU12087.1| hypothetical protein TSUD_00530 [Trifolium subterraneum] Length = 1851 Score = 59.7 bits (143), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%), Gaps = 1/38 (2%) Frame = +1 Query: 319 MSSRGGPSQ-QNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSR GPS+ Q P LQRRITRTQT GNLGE+IFDSEVV Sbjct: 1 MSSRPGPSESQGPPLQRRITRTQTAGNLGEAIFDSEVV 38 >gb|PNY17494.1| callose synthase 3-like protein [Trifolium pratense] Length = 463 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = +1 Query: 319 MSSRGGPSQ--QNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSR GPS Q P LQRRITRTQT GNLGE+IFDSEVV Sbjct: 1 MSSRAGPSSESQGPPLQRRITRTQTAGNLGEAIFDSEVV 39 >ref|XP_022154081.1| callose synthase 3 isoform X2 [Momordica charantia] Length = 1949 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG S Q P LQRRITRTQT GNLGES+FDSEVV Sbjct: 1 MSSRGG-SDQPPPLQRRITRTQTTGNLGESVFDSEVV 36 >ref|XP_022154079.1| callose synthase 3 isoform X1 [Momordica charantia] Length = 1950 Score = 59.3 bits (142), Expect = 2e-07 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG S Q P LQRRITRTQT GNLGES+FDSEVV Sbjct: 1 MSSRGG-SDQPPPLQRRITRTQTTGNLGESVFDSEVV 36 >ref|XP_021821428.1| callose synthase 3 [Prunus avium] ref|XP_021821429.1| callose synthase 3 [Prunus avium] Length = 1957 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 322 SSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 SSRGG Q PQLQRR+TRTQT GNLGE+ FDSEVV Sbjct: 3 SSRGGSDQPPPQLQRRLTRTQTAGNLGETAFDSEVV 38 >ref|XP_020420986.1| callose synthase 3 [Prunus persica] ref|XP_020420987.1| callose synthase 3 [Prunus persica] gb|ONH99148.1| hypothetical protein PRUPE_6G014400 [Prunus persica] gb|ONH99149.1| hypothetical protein PRUPE_6G014400 [Prunus persica] gb|ONH99150.1| hypothetical protein PRUPE_6G014400 [Prunus persica] Length = 1957 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 322 SSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 SSRGG Q PQLQRR+TRTQT GNLGE+ FDSEVV Sbjct: 3 SSRGGSDQPPPQLQRRLTRTQTAGNLGETAFDSEVV 38 >ref|XP_008243622.1| PREDICTED: callose synthase 3 [Prunus mume] ref|XP_016652120.1| PREDICTED: callose synthase 3 [Prunus mume] Length = 1957 Score = 58.5 bits (140), Expect = 4e-07 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +1 Query: 322 SSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 SSRGG Q PQLQRR+TRTQT GNLGE+ FDSEVV Sbjct: 3 SSRGGSDQPPPQLQRRLTRTQTAGNLGETAFDSEVV 38 >ref|XP_023531977.1| callose synthase 3-like [Cucurbita pepo subsp. pepo] Length = 1949 Score = 57.8 bits (138), Expect = 7e-07 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG S Q P LQRRITRTQT GNLGES FDSEVV Sbjct: 1 MSSRGG-SDQPPPLQRRITRTQTTGNLGESAFDSEVV 36 >ref|XP_022966525.1| callose synthase 3-like [Cucurbita maxima] ref|XP_022966529.1| callose synthase 3-like [Cucurbita maxima] ref|XP_022966536.1| callose synthase 3-like [Cucurbita maxima] ref|XP_022966537.1| callose synthase 3-like [Cucurbita maxima] Length = 1951 Score = 57.8 bits (138), Expect = 7e-07 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = +1 Query: 319 MSSRGGPSQQNPQLQRRITRTQTVGNLGESIFDSEVV 429 MSSRGG S Q P LQRRITRTQT GNLGES FDSEVV Sbjct: 1 MSSRGG-SDQPPPLQRRITRTQTTGNLGESAFDSEVV 36