BLASTX nr result
ID: Rehmannia32_contig00001406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia32_contig00001406 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022859823.1| cytochrome b-c1 complex subunit 8-like [Olea... 82 6e-18 ref|XP_011080633.1| cytochrome b-c1 complex subunit 8 [Sesamum i... 81 2e-17 gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] 80 7e-17 ref|XP_022859210.1| cytochrome b-c1 complex subunit 8 [Olea euro... 79 1e-16 ref|XP_011084228.1| cytochrome b-c1 complex subunit 8-like [Sesa... 79 2e-16 ref|XP_012843291.1| PREDICTED: cytochrome b-c1 complex subunit 8... 79 2e-16 ref|XP_021756438.1| cytochrome b-c1 complex subunit 8-like [Chen... 76 2e-15 ref|XP_009590906.1| PREDICTED: cytochrome b-c1 complex subunit 8... 76 2e-15 ref|XP_009793973.1| PREDICTED: cytochrome b-c1 complex subunit 8... 76 2e-15 ref|XP_019255921.1| PREDICTED: cytochrome b-c1 complex subunit 8... 75 6e-15 gb|OMO89969.1| Cytochrome b-c1 complex subunit 8 [Corchorus olit... 74 9e-15 ref|XP_022846435.1| cytochrome b-c1 complex subunit 8-like [Olea... 74 1e-14 gb|PIA59692.1| hypothetical protein AQUCO_00400529v1 [Aquilegia ... 74 1e-14 ref|XP_019702647.1| PREDICTED: cytochrome b-c1 complex subunit 8... 74 1e-14 ref|XP_021755200.1| cytochrome b-c1 complex subunit 8-like [Chen... 74 2e-14 ref|XP_021636345.1| cytochrome b-c1 complex subunit 8 [Hevea bra... 73 3e-14 gb|KCW65810.1| hypothetical protein EUGRSUZ_G03166 [Eucalyptus g... 73 3e-14 ref|XP_020087680.1| cytochrome b-c1 complex subunit 8-like [Anan... 73 4e-14 ref|XP_010692002.1| PREDICTED: cytochrome b-c1 complex subunit 8... 73 4e-14 ref|XP_022764434.1| cytochrome b-c1 complex subunit 8-like [Duri... 72 5e-14 >ref|XP_022859823.1| cytochrome b-c1 complex subunit 8-like [Olea europaea var. sylvestris] Length = 72 Score = 82.4 bits (202), Expect = 6e-18 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HKIS+NWIS TLLLSPLVGTYSYVQWYQEKEKMEHRY Sbjct: 33 KIHHKISENWISATLLLSPLVGTYSYVQWYQEKEKMEHRY 72 >ref|XP_011080633.1| cytochrome b-c1 complex subunit 8 [Sesamum indicum] Length = 72 Score = 80.9 bits (198), Expect = 2e-17 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HKIS+NW+S TLLL PLVGTYSYVQWYQEKEKMEHRY Sbjct: 33 KIGHKISENWLSATLLLGPLVGTYSYVQWYQEKEKMEHRY 72 >gb|EPS57976.1| hypothetical protein M569_16841 [Genlisea aurea] Length = 72 Score = 79.7 bits (195), Expect = 7e-17 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI+HK+S+NW+S TLLL+PLVGTYSYV+WYQEKEKMEHRY Sbjct: 33 KISHKVSENWLSATLLLTPLVGTYSYVKWYQEKEKMEHRY 72 >ref|XP_022859210.1| cytochrome b-c1 complex subunit 8 [Olea europaea var. sylvestris] Length = 72 Score = 79.3 bits (194), Expect = 1e-16 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI+HKIS+NWIS TLLL PLVGTYSYVQWY EKEKMEHRY Sbjct: 33 KISHKISENWISATLLLGPLVGTYSYVQWYLEKEKMEHRY 72 >ref|XP_011084228.1| cytochrome b-c1 complex subunit 8-like [Sesamum indicum] Length = 72 Score = 78.6 bits (192), Expect = 2e-16 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KIAHKISDNW++ TLLL PLVGTYSYVQWYQE EKM HRY Sbjct: 33 KIAHKISDNWLNATLLLGPLVGTYSYVQWYQEAEKMNHRY 72 >ref|XP_012843291.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Erythranthe guttata] gb|EYU46040.1| hypothetical protein MIMGU_mgv1a017481mg [Erythranthe guttata] Length = 72 Score = 78.6 bits (192), Expect = 2e-16 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KIAHK+SD+WI TLLL PLV TYSYVQWYQEKEKMEHRY Sbjct: 33 KIAHKVSDSWIGATLLLGPLVSTYSYVQWYQEKEKMEHRY 72 >ref|XP_021756438.1| cytochrome b-c1 complex subunit 8-like [Chenopodium quinoa] Length = 72 Score = 76.3 bits (186), Expect = 2e-15 Identities = 31/40 (77%), Positives = 36/40 (90%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 K+ HK+++NWISTTLLL PLVG YSYV WYQEKEK+EHRY Sbjct: 33 KLTHKVTENWISTTLLLGPLVGVYSYVNWYQEKEKLEHRY 72 >ref|XP_009590906.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana tomentosiformis] ref|XP_016453992.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana tabacum] Length = 72 Score = 76.3 bits (186), Expect = 2e-15 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HK+S+NWIS TLLL+PLVGTYSYVQ+YQEKEK+EHRY Sbjct: 33 KIHHKVSENWISATLLLAPLVGTYSYVQYYQEKEKLEHRY 72 >ref|XP_009793973.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana sylvestris] ref|XP_016470030.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana tabacum] Length = 72 Score = 75.9 bits (185), Expect = 2e-15 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HK+S+NWIS TLLL+PL+GTYSYVQ+YQEKEK+EHRY Sbjct: 33 KIHHKVSENWISATLLLAPLIGTYSYVQYYQEKEKLEHRY 72 >ref|XP_019255921.1| PREDICTED: cytochrome b-c1 complex subunit 8-like [Nicotiana attenuata] Length = 72 Score = 74.7 bits (182), Expect = 6e-15 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HK+S+NWIS TL L+PLVGTYSYVQ+YQEKEK+EHRY Sbjct: 33 KIHHKVSENWISATLFLAPLVGTYSYVQYYQEKEKLEHRY 72 >gb|OMO89969.1| Cytochrome b-c1 complex subunit 8 [Corchorus olitorius] Length = 72 Score = 74.3 bits (181), Expect = 9e-15 Identities = 32/40 (80%), Positives = 38/40 (95%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI+HK+S+NWIS TLLL+PLVGTY+YVQ YQEKEK+EHRY Sbjct: 33 KISHKVSENWISATLLLAPLVGTYTYVQRYQEKEKLEHRY 72 >ref|XP_022846435.1| cytochrome b-c1 complex subunit 8-like [Olea europaea var. sylvestris] Length = 72 Score = 73.9 bits (180), Expect = 1e-14 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HKI +NWI+ TLLL PLVGTYS VQWYQEKEKMEHRY Sbjct: 33 KINHKIFENWINATLLLGPLVGTYSNVQWYQEKEKMEHRY 72 >gb|PIA59692.1| hypothetical protein AQUCO_00400529v1 [Aquilegia coerulea] Length = 72 Score = 73.9 bits (180), Expect = 1e-14 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 K++HK+S+NWISTTLLL+PLVG Y+YVQ YQEKEK+EHRY Sbjct: 33 KLSHKVSENWISTTLLLAPLVGVYTYVQTYQEKEKLEHRY 72 >ref|XP_019702647.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Elaeis guineensis] Length = 72 Score = 73.9 bits (180), Expect = 1e-14 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HK+S+NWIS TLLL+PLVGTYSYVQ+YQEKEK+ HRY Sbjct: 33 KIHHKVSENWISATLLLAPLVGTYSYVQYYQEKEKLAHRY 72 >ref|XP_021755200.1| cytochrome b-c1 complex subunit 8-like [Chenopodium quinoa] Length = 72 Score = 73.6 bits (179), Expect = 2e-14 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 K+ HK+++NWISTTLLL PLVG YSYV WY EKEK+EHRY Sbjct: 33 KLTHKVTENWISTTLLLGPLVGVYSYVNWYLEKEKLEHRY 72 >ref|XP_021636345.1| cytochrome b-c1 complex subunit 8 [Hevea brasiliensis] Length = 72 Score = 73.2 bits (178), Expect = 3e-14 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HK+S+NWIS TLLLSPLVGTY+YVQ Y+EKEK+EHRY Sbjct: 33 KIHHKVSENWISATLLLSPLVGTYTYVQHYKEKEKLEHRY 72 >gb|KCW65810.1| hypothetical protein EUGRSUZ_G03166 [Eucalyptus grandis] Length = 72 Score = 73.2 bits (178), Expect = 3e-14 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HKIS+NWIS TLLL+PLVGTY+YVQ YQEKEK+EHRY Sbjct: 33 KIHHKISENWISATLLLAPLVGTYTYVQNYQEKEKLEHRY 72 >ref|XP_020087680.1| cytochrome b-c1 complex subunit 8-like [Ananas comosus] gb|OAY80364.1| Cytochrome b-c1 complex subunit 8 [Ananas comosus] Length = 72 Score = 72.8 bits (177), Expect = 4e-14 Identities = 31/40 (77%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI HK+S+NW+S TLLLSPLVGTYSYVQ+Y+EKEK+ HRY Sbjct: 33 KIHHKVSENWLSATLLLSPLVGTYSYVQYYKEKEKLAHRY 72 >ref|XP_010692002.1| PREDICTED: cytochrome b-c1 complex subunit 8 [Beta vulgaris subsp. vulgaris] gb|KMS99888.1| hypothetical protein BVRB_1g017370 [Beta vulgaris subsp. vulgaris] Length = 72 Score = 72.8 bits (177), Expect = 4e-14 Identities = 29/40 (72%), Positives = 37/40 (92%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 K++HK+++NWIS TLLL+PLVG YSYV WYQEKEK+EHR+ Sbjct: 33 KLSHKVTENWISATLLLTPLVGVYSYVGWYQEKEKLEHRF 72 >ref|XP_022764434.1| cytochrome b-c1 complex subunit 8-like [Durio zibethinus] Length = 72 Score = 72.4 bits (176), Expect = 5e-14 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = +3 Query: 3 KIAHKISDNWISTTLLLSPLVGTYSYVQWYQEKEKMEHRY 122 KI+HK+S+NWIS TLLL+PLVGTY+YVQ Y+EKEK+EHRY Sbjct: 33 KISHKVSENWISATLLLTPLVGTYAYVQNYKEKEKLEHRY 72