BLASTX nr result
ID: Rehmannia31_contig00029715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00029715 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM98225.1| hypothetical protein CDL12_29297 [Handroanthus im... 61 7e-09 ref|XP_011075260.1| metal tolerance protein C2 [Sesamum indicum] 63 1e-08 ref|XP_020539940.1| metal tolerance protein C2-like [Jatropha cu... 58 3e-08 ref|XP_007134921.1| hypothetical protein PHAVU_010G086900g [Phas... 61 4e-08 gb|KHN45432.1| Metal tolerance protein C2 [Glycine soja] 61 5e-08 ref|XP_003554213.1| PREDICTED: metal tolerance protein C2 [Glyci... 61 5e-08 ref|XP_020212424.1| metal tolerance protein C2 [Cajanus cajan] 61 5e-08 gb|KYP70612.1| Metal tolerance protein C2, partial [Cajanus cajan] 61 5e-08 gb|PIN03617.1| putative Zn2+ transporter MSC2 (cation diffusion ... 61 5e-08 gb|OVA13076.1| Cation efflux protein [Macleaya cordata] 61 6e-08 ref|XP_015969432.1| metal tolerance protein C2 [Arachis duranens... 60 7e-08 gb|PON45323.1| Cation efflux protein [Trema orientalis] 60 7e-08 ref|XP_022846720.1| metal tolerance protein C2 [Olea europaea va... 60 1e-07 ref|XP_002323276.2| hypothetical protein POPTR_0016s04430g [Popu... 60 1e-07 gb|PON44496.1| Cation efflux protein [Parasponia andersonii] 60 1e-07 ref|XP_012834400.1| PREDICTED: metal tolerance protein C2 [Eryth... 60 1e-07 ref|XP_024038007.1| metal tolerance protein C2 isoform X2 [Citru... 60 1e-07 ref|XP_006429885.1| metal tolerance protein C2 isoform X1 [Citru... 60 1e-07 ref|XP_021803739.1| metal tolerance protein C2-like [Prunus avium] 58 2e-07 gb|KHN07434.1| Metal tolerance protein C2 [Glycine soja] 59 2e-07 >gb|PIM98225.1| hypothetical protein CDL12_29297 [Handroanthus impetiginosus] Length = 143 Score = 60.8 bits (146), Expect = 7e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VKQG DD+PILQYVHGLYHDLG+QDLTVQ + Sbjct: 111 VKQGADDRPILQYVHGLYHDLGIQDLTVQIE 141 >ref|XP_011075260.1| metal tolerance protein C2 [Sesamum indicum] Length = 378 Score = 62.8 bits (151), Expect = 1e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VKQG DD PILQYVHG+YHDLG+QDLTVQTD Sbjct: 346 VKQGMDDYPILQYVHGMYHDLGIQDLTVQTD 376 >ref|XP_020539940.1| metal tolerance protein C2-like [Jatropha curcas] Length = 96 Score = 58.2 bits (139), Expect = 3e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD+P LQ+VHGLYHDLGV+DLTVQTD Sbjct: 64 VKKGMDDRPTLQFVHGLYHDLGVRDLTVQTD 94 >ref|XP_007134921.1| hypothetical protein PHAVU_010G086900g [Phaseolus vulgaris] gb|ESW06915.1| hypothetical protein PHAVU_010G086900g [Phaseolus vulgaris] Length = 369 Score = 61.2 bits (147), Expect = 4e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GT+D+PIL++VHGLYHDLGVQDLTVQTD Sbjct: 337 VKEGTNDRPILEFVHGLYHDLGVQDLTVQTD 367 >gb|KHN45432.1| Metal tolerance protein C2 [Glycine soja] Length = 363 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GT+D+PIL++VHGLYHDLGVQDLTVQTD Sbjct: 331 VKKGTNDRPILEFVHGLYHDLGVQDLTVQTD 361 >ref|XP_003554213.1| PREDICTED: metal tolerance protein C2 [Glycine max] gb|KRG95393.1| hypothetical protein GLYMA_19G148200 [Glycine max] Length = 363 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GT+D+PIL++VHGLYHDLGVQDLTVQTD Sbjct: 331 VKKGTNDRPILEFVHGLYHDLGVQDLTVQTD 361 >ref|XP_020212424.1| metal tolerance protein C2 [Cajanus cajan] Length = 368 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GT+D+PIL++VHGLYHDLGVQDLTVQTD Sbjct: 336 VKKGTNDRPILEFVHGLYHDLGVQDLTVQTD 366 >gb|KYP70612.1| Metal tolerance protein C2, partial [Cajanus cajan] Length = 374 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GT+D+PIL++VHGLYHDLGVQDLTVQTD Sbjct: 342 VKKGTNDRPILEFVHGLYHDLGVQDLTVQTD 372 >gb|PIN03617.1| putative Zn2+ transporter MSC2 (cation diffusion facilitator superfamily) [Handroanthus impetiginosus] Length = 390 Score = 60.8 bits (146), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VKQG DD+PILQYVHGLYHDLG+QDLTVQ + Sbjct: 358 VKQGADDRPILQYVHGLYHDLGIQDLTVQIE 388 >gb|OVA13076.1| Cation efflux protein [Macleaya cordata] Length = 413 Score = 60.8 bits (146), Expect = 6e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G+DD P+L YVHGLYHDLGVQDLT+QTD Sbjct: 381 VKKGSDDHPVLHYVHGLYHDLGVQDLTIQTD 411 >ref|XP_015969432.1| metal tolerance protein C2 [Arachis duranensis] ref|XP_016204907.1| metal tolerance protein C2 isoform X1 [Arachis ipaensis] ref|XP_016204908.1| metal tolerance protein C2 isoform X3 [Arachis ipaensis] ref|XP_020959406.1| metal tolerance protein C2 isoform X2 [Arachis ipaensis] Length = 380 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD+PIL++VHGLYHDLGVQDLTVQTD Sbjct: 348 VKKGIDDRPILEFVHGLYHDLGVQDLTVQTD 378 >gb|PON45323.1| Cation efflux protein [Trema orientalis] Length = 401 Score = 60.5 bits (145), Expect = 7e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GTDD+ ILQYVHGLYH+LG+QDLTVQTD Sbjct: 369 VKKGTDDRSILQYVHGLYHELGIQDLTVQTD 399 >ref|XP_022846720.1| metal tolerance protein C2 [Olea europaea var. sylvestris] Length = 386 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD PILQYVHGLYHDLGV+DLTV+TD Sbjct: 354 VKKGMDDHPILQYVHGLYHDLGVKDLTVETD 384 >ref|XP_002323276.2| hypothetical protein POPTR_0016s04430g [Populus trichocarpa] gb|PNS97847.1| hypothetical protein POPTR_016G045200v3 [Populus trichocarpa] Length = 386 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD+PILQ+VHGLYHDLGVQDLTVQT+ Sbjct: 354 VKEGVDDRPILQWVHGLYHDLGVQDLTVQTN 384 >gb|PON44496.1| Cation efflux protein [Parasponia andersonii] Length = 398 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK GTDD+ ILQYVHGLYH+LG+QDLTVQTD Sbjct: 366 VKMGTDDRSILQYVHGLYHELGIQDLTVQTD 396 >ref|XP_012834400.1| PREDICTED: metal tolerance protein C2 [Erythranthe guttata] gb|EYU39946.1| hypothetical protein MIMGU_mgv1a007675mg [Erythranthe guttata] Length = 399 Score = 60.1 bits (144), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK G DDQPILQYVHG+YH+LGVQDLTVQT+ Sbjct: 367 VKSGMDDQPILQYVHGVYHELGVQDLTVQTE 397 >ref|XP_024038007.1| metal tolerance protein C2 isoform X2 [Citrus clementina] Length = 350 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD+PILQ+VHGLYHDLGVQDLTVQ D Sbjct: 318 VKKGVDDRPILQFVHGLYHDLGVQDLTVQID 348 >ref|XP_006429885.1| metal tolerance protein C2 isoform X1 [Citrus clementina] gb|ESR43125.1| hypothetical protein CICLE_v10011987mg [Citrus clementina] Length = 373 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD+PILQ+VHGLYHDLGVQDLTVQ D Sbjct: 341 VKKGVDDRPILQFVHGLYHDLGVQDLTVQID 371 >ref|XP_021803739.1| metal tolerance protein C2-like [Prunus avium] Length = 168 Score = 57.8 bits (138), Expect = 2e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+G DD+PILQ VHGLYHDLG+QDLTVQ D Sbjct: 136 VKKGIDDRPILQLVHGLYHDLGIQDLTVQAD 166 >gb|KHN07434.1| Metal tolerance protein C2 [Glycine soja] Length = 363 Score = 59.3 bits (142), Expect = 2e-07 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -2 Query: 437 VKQGTDDQPILQYVHGLYHDLGVQDLTVQTD 345 VK+GT+D+PIL++VHGL+HDLGVQDLTVQTD Sbjct: 331 VKKGTNDRPILEFVHGLFHDLGVQDLTVQTD 361