BLASTX nr result
ID: Rehmannia31_contig00028670
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00028670 (579 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PPS10666.1| hypothetical protein GOBAR_AA09977 [Gossypium bar... 57 3e-06 gb|PPE01735.1| hypothetical protein GOBAR_DD01235 [Gossypium bar... 57 3e-06 >gb|PPS10666.1| hypothetical protein GOBAR_AA09977 [Gossypium barbadense] Length = 300 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 121 IFEQLLLDWLIQYTTIRYELGRQPANTKLSSNKTVRRVRV 2 I E L+ D ++ T RYELGRQPANTKLSSNKTVRR+RV Sbjct: 45 IMEGLMFDLFLEGGTERYELGRQPANTKLSSNKTVRRIRV 84 >gb|PPE01735.1| hypothetical protein GOBAR_DD01235 [Gossypium barbadense] Length = 304 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -3 Query: 121 IFEQLLLDWLIQYTTIRYELGRQPANTKLSSNKTVRRVRV 2 I E L+ D ++ T RYELGRQPANTKLSSNKTVRR+RV Sbjct: 95 IMEGLMFDLFLEGGTERYELGRQPANTKLSSNKTVRRIRV 134