BLASTX nr result
ID: Rehmannia31_contig00026066
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00026066 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848554.1| PREDICTED: uncharacterized protein LOC105968... 57 2e-07 >ref|XP_012848554.1| PREDICTED: uncharacterized protein LOC105968466 [Erythranthe guttata] gb|EYU27961.1| hypothetical protein MIMGU_mgv1a015869mg [Erythranthe guttata] Length = 142 Score = 57.0 bits (136), Expect = 2e-07 Identities = 31/59 (52%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +1 Query: 1 CVAGCGYKFNIPLEKVNQVHSRXXXXXXXXXXXXXVVESMP--SDVTKPGPDEILSTSA 171 C++GCGYKF+IPLEKV+QVHSR V ES S+V KP P EI +TSA Sbjct: 84 CISGCGYKFDIPLEKVSQVHSRPPKDPVEEKPHAPVGESSSKISNVVKPPPGEIPTTSA 142