BLASTX nr result
ID: Rehmannia31_contig00022241
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00022241 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095159.1| thioredoxin H9 isoform X2 [Sesamum indicum] ... 61 2e-09 gb|PON38424.1| Thioredoxin [Parasponia andersonii] 59 1e-08 gb|PON45590.1| Thioredoxin [Trema orientalis] 57 4e-08 ref|XP_012832301.1| PREDICTED: thioredoxin H9 [Erythranthe gutta... 58 5e-08 emb|CDP06377.1| unnamed protein product [Coffea canephora] 57 7e-08 ref|XP_019162433.1| PREDICTED: thioredoxin H9-like isoform X2 [I... 55 5e-07 ref|XP_022890881.1| thioredoxin H-type-like [Olea europaea var. ... 55 5e-07 ref|XP_023905268.1| thioredoxin H9 isoform X1 [Quercus suber] >g... 54 1e-06 ref|XP_019162430.1| PREDICTED: thioredoxin H9-like isoform X1 [I... 54 1e-06 gb|PIN14432.1| Thioredoxin [Handroanthus impetiginosus] 54 2e-06 ref|XP_018819367.1| PREDICTED: thioredoxin H-type-like isoform X... 52 6e-06 >ref|XP_011095159.1| thioredoxin H9 isoform X2 [Sesamum indicum] ref|XP_011095160.1| thioredoxin H9 isoform X2 [Sesamum indicum] ref|XP_011095161.1| thioredoxin H9 isoform X2 [Sesamum indicum] Length = 139 Score = 61.2 bits (147), Expect = 2e-09 Identities = 27/31 (87%), Positives = 27/31 (87%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MGHCLAK GDDSDHNVEFAGGNVHLITT Sbjct: 1 MGHCLAKHNKGGDDSDHNVEFAGGNVHLITT 31 >gb|PON38424.1| Thioredoxin [Parasponia andersonii] Length = 98 Score = 58.5 bits (140), Expect = 1e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MG C+ KPK+DGDDSDHNVEF+GGNV++ITT Sbjct: 1 MGLCMTKPKDDGDDSDHNVEFSGGNVNIITT 31 >gb|PON45590.1| Thioredoxin [Trema orientalis] Length = 98 Score = 57.0 bits (136), Expect = 4e-08 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLIT 5 MG C KPK+DGDDSDHNVEFAGGNV++IT Sbjct: 1 MGLCFTKPKDDGDDSDHNVEFAGGNVNIIT 30 >ref|XP_012832301.1| PREDICTED: thioredoxin H9 [Erythranthe guttata] ref|XP_012832302.1| PREDICTED: thioredoxin H9 [Erythranthe guttata] gb|EYU42040.1| hypothetical protein MIMGU_mgv1a015977mg [Erythranthe guttata] gb|EYU42041.1| hypothetical protein MIMGU_mgv1a015977mg [Erythranthe guttata] Length = 139 Score = 57.8 bits (138), Expect = 5e-08 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MG CLAK +DGDDSDHNVEFAGGNV LITT Sbjct: 1 MGSCLAKSTSDGDDSDHNVEFAGGNVQLITT 31 >emb|CDP06377.1| unnamed protein product [Coffea canephora] Length = 139 Score = 57.4 bits (137), Expect = 7e-08 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MG CL KPKNDGD+S HN EF GGNVHLITT Sbjct: 1 MGCCLPKPKNDGDESVHNAEFVGGNVHLITT 31 >ref|XP_019162433.1| PREDICTED: thioredoxin H9-like isoform X2 [Ipomoea nil] ref|XP_019162434.1| PREDICTED: thioredoxin H9-like isoform X2 [Ipomoea nil] Length = 147 Score = 55.5 bits (132), Expect = 5e-07 Identities = 28/39 (71%), Positives = 29/39 (74%), Gaps = 8/39 (20%) Frame = -1 Query: 94 MGHCLAK--------PKNDGDDSDHNVEFAGGNVHLITT 2 MGH LAK KNDGDDSDH+VEFAGGNVHLITT Sbjct: 1 MGHILAKLCFVPKQRSKNDGDDSDHHVEFAGGNVHLITT 39 >ref|XP_022890881.1| thioredoxin H-type-like [Olea europaea var. sylvestris] ref|XP_022890882.1| thioredoxin H-type-like [Olea europaea var. sylvestris] ref|XP_022890883.1| thioredoxin H-type-like [Olea europaea var. sylvestris] Length = 139 Score = 55.1 bits (131), Expect = 5e-07 Identities = 25/31 (80%), Positives = 25/31 (80%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MG CLAK K DGDDSDHN EF GGNV LITT Sbjct: 1 MGLCLAKHKRDGDDSDHNFEFTGGNVQLITT 31 >ref|XP_023905268.1| thioredoxin H9 isoform X1 [Quercus suber] gb|POF26977.1| thioredoxin h9 [Quercus suber] Length = 139 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MG+C+ KP+ DG DSD NVEF+GGNVHLITT Sbjct: 1 MGNCVTKPETDGYDSDKNVEFSGGNVHLITT 31 >ref|XP_019162430.1| PREDICTED: thioredoxin H9-like isoform X1 [Ipomoea nil] ref|XP_019162431.1| PREDICTED: thioredoxin H9-like isoform X1 [Ipomoea nil] ref|XP_019162432.1| PREDICTED: thioredoxin H9-like isoform X1 [Ipomoea nil] Length = 150 Score = 54.3 bits (129), Expect = 1e-06 Identities = 28/42 (66%), Positives = 29/42 (69%), Gaps = 11/42 (26%) Frame = -1 Query: 94 MGHCLAK-----------PKNDGDDSDHNVEFAGGNVHLITT 2 MGH LAK KNDGDDSDH+VEFAGGNVHLITT Sbjct: 1 MGHILAKLCFVPKKLQQRSKNDGDDSDHHVEFAGGNVHLITT 42 >gb|PIN14432.1| Thioredoxin [Handroanthus impetiginosus] Length = 139 Score = 53.5 bits (127), Expect = 2e-06 Identities = 23/31 (74%), Positives = 23/31 (74%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MGHC KP DGDDSD NVE AGGNV LI T Sbjct: 1 MGHCFTKPNKDGDDSDQNVELAGGNVQLIMT 31 >ref|XP_018819367.1| PREDICTED: thioredoxin H-type-like isoform X2 [Juglans regia] ref|XP_018819368.1| PREDICTED: thioredoxin H-type-like isoform X2 [Juglans regia] Length = 139 Score = 52.4 bits (124), Expect = 6e-06 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 94 MGHCLAKPKNDGDDSDHNVEFAGGNVHLITT 2 MG CL KP+ DGDDS+ NV+F+GGNVHLIT+ Sbjct: 1 MGLCLGKPRIDGDDSEENVKFSGGNVHLITS 31