BLASTX nr result
ID: Rehmannia31_contig00018105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018105 (357 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020550751.1| polyadenylate-binding protein-interacting pr... 57 6e-07 gb|PIN14639.1| Protein interacting with poly(A)-binding protein ... 56 1e-06 ref|XP_020252910.1| polyadenylate-binding protein-interacting pr... 55 4e-06 ref|XP_020252909.1| polyadenylate-binding protein-interacting pr... 55 4e-06 ref|XP_020252908.1| polyadenylate-binding protein-interacting pr... 55 4e-06 ref|XP_021649000.1| polyadenylate-binding protein-interacting pr... 54 7e-06 ref|XP_008797716.1| PREDICTED: polyadenylate-binding protein-int... 54 7e-06 ref|XP_021648999.1| polyadenylate-binding protein-interacting pr... 54 7e-06 ref|XP_021648998.1| polyadenylate-binding protein-interacting pr... 54 7e-06 ref|XP_021648997.1| polyadenylate-binding protein-interacting pr... 54 7e-06 ref|XP_021648996.1| polyadenylate-binding protein-interacting pr... 54 7e-06 ref|XP_021648994.1| polyadenylate-binding protein-interacting pr... 54 7e-06 ref|XP_021648992.1| polyadenylate-binding protein-interacting pr... 54 7e-06 >ref|XP_020550751.1| polyadenylate-binding protein-interacting protein 4-like [Sesamum indicum] Length = 631 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQQ+M+GQPRPVLYMPAY P EM YKGREF Sbjct: 602 YGQQVMMGQPRPVLYMPAY-PAEMPYKGREF 631 >gb|PIN14639.1| Protein interacting with poly(A)-binding protein [Handroanthus impetiginosus] Length = 631 Score = 55.8 bits (133), Expect = 1e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ MM+GQPRP+LYMPAY P EM YKGREF Sbjct: 602 YGQHMMMGQPRPILYMPAY-PPEMPYKGREF 631 >ref|XP_020252910.1| polyadenylate-binding protein-interacting protein 4 isoform X3 [Asparagus officinalis] Length = 629 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQQMM+GQPRPV YMPAY P EM YKGR F Sbjct: 600 YGQQMMLGQPRPVYYMPAY-PPEMPYKGRNF 629 >ref|XP_020252909.1| polyadenylate-binding protein-interacting protein 4 isoform X2 [Asparagus officinalis] gb|ONK77280.1| uncharacterized protein A4U43_C02F4920 [Asparagus officinalis] Length = 630 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQQMM+GQPRPV YMPAY P EM YKGR F Sbjct: 601 YGQQMMLGQPRPVYYMPAY-PPEMPYKGRNF 630 >ref|XP_020252908.1| polyadenylate-binding protein-interacting protein 4 isoform X1 [Asparagus officinalis] Length = 634 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQQMM+GQPRPV YMPAY P EM YKGR F Sbjct: 605 YGQQMMLGQPRPVYYMPAY-PPEMPYKGRNF 634 >ref|XP_021649000.1| polyadenylate-binding protein-interacting protein 4-like isoform X9 [Hevea brasiliensis] Length = 639 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 609 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 639 >ref|XP_008797716.1| PREDICTED: polyadenylate-binding protein-interacting protein 4-like [Phoenix dactylifera] Length = 639 Score = 53.9 bits (128), Expect = 7e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQQM++GQPRPV YMP Y P EMQYKGR F Sbjct: 610 YGQQMILGQPRPVYYMPTY-PPEMQYKGRNF 639 >ref|XP_021648999.1| polyadenylate-binding protein-interacting protein 4-like isoform X8 [Hevea brasiliensis] Length = 646 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 616 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 646 >ref|XP_021648998.1| polyadenylate-binding protein-interacting protein 4-like isoform X7 [Hevea brasiliensis] Length = 648 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 618 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 648 >ref|XP_021648997.1| polyadenylate-binding protein-interacting protein 4-like isoform X6 [Hevea brasiliensis] Length = 652 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 622 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 652 >ref|XP_021648996.1| polyadenylate-binding protein-interacting protein 4-like isoform X5 [Hevea brasiliensis] Length = 653 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 623 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 653 >ref|XP_021648994.1| polyadenylate-binding protein-interacting protein 4-like isoform X3 [Hevea brasiliensis] Length = 654 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 624 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 654 >ref|XP_021648992.1| polyadenylate-binding protein-interacting protein 4-like isoform X1 [Hevea brasiliensis] Length = 655 Score = 53.9 bits (128), Expect = 7e-06 Identities = 22/31 (70%), Positives = 25/31 (80%) Frame = -3 Query: 355 YGQQMMIGQPRPVLYMPAYHPTEMQYKGREF 263 YGQ M++G PR VLYMP+Y P EM YKGREF Sbjct: 625 YGQNMLLGHPRQVLYMPSYQPQEMPYKGREF 655