BLASTX nr result
ID: Rehmannia31_contig00018061
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018061 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OMO65188.1| Drought responsive protein [Corchorus olitorius] 63 1e-09 gb|KHG07930.1| dehydration-induced 19 [Gossypium arboreum] 64 1e-09 gb|PON61366.1| Dehydration-induced protein [Trema orientalis] 64 2e-09 dbj|GAY34590.1| hypothetical protein CUMW_012240 [Citrus unshiu]... 64 2e-09 ref|XP_011096346.1| protein DEHYDRATION-INDUCED 19 homolog 4 [Se... 64 2e-09 gb|OMO76362.1| Drought-responsive family protein [Corchorus caps... 63 3e-09 ref|XP_006377400.1| hypothetical protein POPTR_0011s05610g [Popu... 62 4e-09 gb|KOM31003.1| hypothetical protein LR48_Vigan01g055800 [Vigna a... 63 5e-09 gb|PON37880.1| Dehydration-induced protein [Parasponia andersonii] 62 6e-09 ref|XP_010924422.1| PREDICTED: protein DEHYDRATION-INDUCED 19 [E... 61 2e-08 gb|PNT11974.1| hypothetical protein POPTR_011G057200v3 [Populus ... 62 2e-08 gb|KVI01018.1| Drought induced 19/ RING finger protein 114 [Cyna... 61 2e-08 gb|KZV53228.1| protein DEHYDRATION-INDUCED 194-like [Dorcoceras ... 61 3e-08 ref|XP_015956431.1| protein DEHYDRATION-INDUCED 19 isoform X1 [A... 60 4e-08 ref|XP_019445680.1| PREDICTED: protein DEHYDRATION-INDUCED 19 ho... 60 4e-08 gb|KJB34869.1| hypothetical protein B456_006G088100 [Gossypium r... 59 5e-08 gb|PIN06561.1| hypothetical protein CDL12_20888 [Handroanthus im... 59 6e-08 gb|POE89204.1| protein dehydration-induced 19 [Quercus suber] 58 7e-08 gb|KJB34867.1| hypothetical protein B456_006G088100 [Gossypium r... 59 7e-08 gb|ABK93427.1| unknown [Populus trichocarpa] 59 8e-08 >gb|OMO65188.1| Drought responsive protein [Corchorus olitorius] Length = 159 Score = 63.2 bits (152), Expect = 1e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 +YLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 28 DYLQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGGS 66 >gb|KHG07930.1| dehydration-induced 19 [Gossypium arboreum] Length = 223 Score = 63.9 bits (154), Expect = 1e-09 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -2 Query: 124 LTNYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 + NYLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 88 MLNYLQRRCRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 127 >gb|PON61366.1| Dehydration-induced protein [Trema orientalis] Length = 228 Score = 63.9 bits (154), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 NYLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG+ Sbjct: 96 NYLQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGGA 134 >dbj|GAY34590.1| hypothetical protein CUMW_012240 [Citrus unshiu] dbj|GAY34591.1| hypothetical protein CUMW_012240 [Citrus unshiu] Length = 222 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = -2 Query: 124 LTNYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 + NYLQRR RLRR P++Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 89 MLNYLQRRRRLRRVAIPSSQALSLLGRDLREAHLQVLLGGS 129 >ref|XP_011096346.1| protein DEHYDRATION-INDUCED 19 homolog 4 [Sesamum indicum] Length = 232 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 LQRR RLRR P PN+Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 104 LQRRRRLRRIPIPNSQALSLLGRDLREAHLQVLLGGS 140 >gb|OMO76362.1| Drought-responsive family protein [Corchorus capsularis] Length = 226 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 +YLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 95 DYLQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGGS 133 >ref|XP_006377400.1| hypothetical protein POPTR_0011s05610g [Populus trichocarpa] Length = 153 Score = 61.6 bits (148), Expect = 4e-09 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 +YLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 20 DYLQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 57 >gb|KOM31003.1| hypothetical protein LR48_Vigan01g055800 [Vigna angularis] Length = 244 Score = 62.8 bits (151), Expect = 5e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 NY+QRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG+ Sbjct: 111 NYVQRRRRLRRVAIPNSQTLSLLGRDLREAHLQVLLGGA 149 >gb|PON37880.1| Dehydration-induced protein [Parasponia andersonii] Length = 228 Score = 62.4 bits (150), Expect = 6e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 NYLQRR RLRR PN Q+LSLLGRDLREAHLQL GG+ Sbjct: 96 NYLQRRRRLRRVAIPNGQALSLLGRDLREAHLQLLSGGA 134 >ref|XP_010924422.1| PREDICTED: protein DEHYDRATION-INDUCED 19 [Elaeis guineensis] Length = 230 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLG 8 LQRR RLRRFP P++Q+LSLLGRDLREAHLQL LG Sbjct: 101 LQRRRRLRRFPIPSSQTLSLLGRDLREAHLQLLLG 135 >gb|PNT11974.1| hypothetical protein POPTR_011G057200v3 [Populus trichocarpa] Length = 268 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 118 NYLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 +YLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 131 DYLQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 168 >gb|KVI01018.1| Drought induced 19/ RING finger protein 114 [Cynara cardunculus var. scolymus] Length = 215 Score = 60.8 bits (146), Expect = 2e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 115 YLQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 YLQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 81 YLQRRRRLRRVAVPNSQALSLLGRDLREAHLQVLLGG 117 >gb|KZV53228.1| protein DEHYDRATION-INDUCED 194-like [Dorcoceras hygrometricum] Length = 251 Score = 60.8 bits (146), Expect = 3e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 ++RRS+LRR P PNNQ+LSLLG+DLREAHLQ LGGS Sbjct: 119 VKRRSQLRRVPIPNNQALSLLGKDLREAHLQALLGGS 155 >ref|XP_015956431.1| protein DEHYDRATION-INDUCED 19 isoform X1 [Arachis duranensis] ref|XP_016190055.1| protein DEHYDRATION-INDUCED 19 isoform X1 [Arachis ipaensis] Length = 231 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 LQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 100 LQRRRRLRRVAIPNSQTLSLLGRDLREAHLQVLLGGS 136 >ref|XP_019445680.1| PREDICTED: protein DEHYDRATION-INDUCED 19 homolog 4-like isoform X1 [Lupinus angustifolius] gb|OIW10401.1| hypothetical protein TanjilG_05549 [Lupinus angustifolius] Length = 233 Score = 60.1 bits (144), Expect = 4e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 LQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 102 LQRRRRLRRVAIPNSQTLSLLGRDLREAHLQVLLGGS 138 >gb|KJB34869.1| hypothetical protein B456_006G088100 [Gossypium raimondii] gb|KJB34870.1| hypothetical protein B456_006G088100 [Gossypium raimondii] Length = 146 Score = 58.5 bits (140), Expect = 5e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 LQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 15 LQRRCRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 50 >gb|PIN06561.1| hypothetical protein CDL12_20888 [Handroanthus impetiginosus] Length = 210 Score = 59.3 bits (142), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 106 RRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGGS 2 RR RLRR P PN Q+LSLLGRDLREAHLQ+ LGGS Sbjct: 82 RRRRLRRVPIPNGQALSLLGRDLREAHLQVLLGGS 116 >gb|POE89204.1| protein dehydration-induced 19 [Quercus suber] Length = 130 Score = 57.8 bits (138), Expect = 7e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 +QRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 1 MQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 36 >gb|KJB34867.1| hypothetical protein B456_006G088100 [Gossypium raimondii] Length = 172 Score = 58.5 bits (140), Expect = 7e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 LQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 41 LQRRCRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 76 >gb|ABK93427.1| unknown [Populus trichocarpa] Length = 180 Score = 58.5 bits (140), Expect = 8e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 112 LQRRSRLRRFPFPNNQSLSLLGRDLREAHLQLFLGG 5 LQRR RLRR PN+Q+LSLLGRDLREAHLQ+ LGG Sbjct: 102 LQRRRRLRRVAIPNSQALSLLGRDLREAHLQVLLGG 137