BLASTX nr result
ID: Rehmannia31_contig00009482
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00009482 (593 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089861.2| interactor of constitutive active ROPs 3 [Se... 140 4e-35 gb|PIN10706.1| hypothetical protein CDL12_16705 [Handroanthus im... 133 1e-32 ref|XP_015874369.1| PREDICTED: interactor of constitutive active... 121 4e-31 gb|PIN06462.1| hypothetical protein CDL12_20984 [Handroanthus im... 126 4e-30 gb|EOY33116.1| ROP interactive partner 5 isoform 4 [Theobroma ca... 124 9e-30 ref|XP_007015498.2| PREDICTED: interactor of constitutive active... 124 2e-29 gb|EOY33117.1| ROP interactive partner 5 isoform 5 [Theobroma ca... 124 2e-29 ref|XP_007015496.2| PREDICTED: interactor of constitutive active... 124 2e-29 gb|EOY33114.1| ROP interactive partner 5 isoform 2 [Theobroma ca... 124 2e-29 ref|XP_021278402.1| interactor of constitutive active ROPs 3 iso... 124 2e-29 ref|XP_021278396.1| interactor of constitutive active ROPs 3 iso... 124 3e-29 ref|XP_022756681.1| interactor of constitutive active ROPs 3-lik... 120 4e-28 ref|XP_022731952.1| interactor of constitutive active ROPs 3-lik... 120 6e-28 ref|XP_022875087.1| interactor of constitutive active ROPs 3-lik... 119 1e-27 ref|XP_015582753.1| PREDICTED: interactor of constitutive active... 118 2e-27 gb|EEF30117.1| ATP binding protein, putative [Ricinus communis] 118 2e-27 gb|OMO71202.1| putative ATP binding protein [Corchorus capsularis] 118 2e-27 gb|OMO77247.1| putative ATP binding protein [Corchorus olitorius] 118 2e-27 ref|XP_012485254.1| PREDICTED: interactor of constitutive active... 118 2e-27 gb|PPD91339.1| hypothetical protein GOBAR_DD11739 [Gossypium bar... 118 2e-27 >ref|XP_011089861.2| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552496.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552497.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552498.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552499.1| interactor of constitutive active ROPs 3 [Sesamum indicum] ref|XP_020552500.1| interactor of constitutive active ROPs 3 [Sesamum indicum] Length = 634 Score = 140 bits (352), Expect = 4e-35 Identities = 72/84 (85%), Positives = 74/84 (88%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG +MERTGSMDS+Y SPRTGKISSPYADDLD Sbjct: 552 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGHLMERTGSMDSNY-SPRTGKISSPYADDLD 610 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 EDLMKKKNANMLRRFGVLWKK QK Sbjct: 611 EDLMKKKNANMLRRFGVLWKKPQK 634 >gb|PIN10706.1| hypothetical protein CDL12_16705 [Handroanthus impetiginosus] Length = 616 Score = 133 bits (334), Expect = 1e-32 Identities = 69/85 (81%), Positives = 74/85 (87%), Gaps = 1/85 (1%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQ+DQW K AMLSAGNNG I+ERTGSMDSHY SPRTGK+SSPYADDLD Sbjct: 533 AELRRLKVQADQWRKAAEAAAAMLSAGNNGHIVERTGSMDSHY-SPRTGKVSSPYADDLD 591 Query: 412 -EDLMKKKNANMLRRFGVLWKKQQK 341 E+L+KKKNANMLRRFGVLWKK QK Sbjct: 592 EEELLKKKNANMLRRFGVLWKKPQK 616 >ref|XP_015874369.1| PREDICTED: interactor of constitutive active ROPs 3-like [Ziziphus jujuba] Length = 201 Score = 121 bits (304), Expect = 4e-31 Identities = 59/83 (71%), Positives = 70/83 (84%) Frame = -2 Query: 589 ELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDE 410 ELRRLKVQSDQW K AMLSAGNNG++MERTGS+DS+Y P TGKISSPY++D+D+ Sbjct: 120 ELRRLKVQSDQWRKAAEAAAAMLSAGNNGKVMERTGSLDSNY-DPVTGKISSPYSEDIDD 178 Query: 409 DLMKKKNANMLRRFGVLWKKQQK 341 DL+KKKN NML++ GVLWKK QK Sbjct: 179 DLLKKKNGNMLKKIGVLWKKPQK 201 >gb|PIN06462.1| hypothetical protein CDL12_20984 [Handroanthus impetiginosus] Length = 650 Score = 126 bits (316), Expect = 4e-30 Identities = 64/84 (76%), Positives = 72/84 (85%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQ+ K +MLSAGNNG++MERTGSMDS Y SPRT +ISSPY DDLD Sbjct: 568 AELRRLKVQSDQFRKAAEAAASMLSAGNNGKLMERTGSMDSGY-SPRTRRISSPYTDDLD 626 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKNAN+LRRFGVLWKK QK Sbjct: 627 DDLLKKKNANLLRRFGVLWKKPQK 650 >gb|EOY33116.1| ROP interactive partner 5 isoform 4 [Theobroma cacao] Length = 509 Score = 124 bits (311), Expect = 9e-30 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D Sbjct: 427 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMD 485 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 486 DDLLKKKNGNMLKKIGVLWKKPQK 509 >ref|XP_007015498.2| PREDICTED: interactor of constitutive active ROPs 3 isoform X2 [Theobroma cacao] Length = 619 Score = 124 bits (311), Expect = 2e-29 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D Sbjct: 537 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMD 595 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 596 DDLLKKKNGNMLKKIGVLWKKPQK 619 >gb|EOY33117.1| ROP interactive partner 5 isoform 5 [Theobroma cacao] Length = 621 Score = 124 bits (311), Expect = 2e-29 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D Sbjct: 539 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMD 597 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 598 DDLLKKKNGNMLKKIGVLWKKPQK 621 >ref|XP_007015496.2| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Theobroma cacao] ref|XP_017982913.1| PREDICTED: interactor of constitutive active ROPs 3 isoform X1 [Theobroma cacao] Length = 624 Score = 124 bits (311), Expect = 2e-29 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D Sbjct: 542 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMD 600 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 601 DDLLKKKNGNMLKKIGVLWKKPQK 624 >gb|EOY33114.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] gb|EOY33115.1| ROP interactive partner 5 isoform 2 [Theobroma cacao] Length = 624 Score = 124 bits (311), Expect = 2e-29 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DSHY +P TGK+SSPY +D+D Sbjct: 542 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSHY-NPVTGKVSSPYTEDMD 600 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 601 DDLLKKKNGNMLKKIGVLWKKPQK 624 >ref|XP_021278402.1| interactor of constitutive active ROPs 3 isoform X2 [Herrania umbratica] Length = 619 Score = 124 bits (310), Expect = 2e-29 Identities = 60/84 (71%), Positives = 71/84 (84%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAG+NG+ MERTGS+DSHY +P TGK+SSPYA+D+D Sbjct: 537 AELRRLKVQSDQWRKAAEAAAAMLSAGHNGKFMERTGSLDSHY-NPVTGKVSSPYAEDMD 595 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 596 DDLLKKKNGNMLKKIGVLWKKPQK 619 >ref|XP_021278396.1| interactor of constitutive active ROPs 3 isoform X1 [Herrania umbratica] ref|XP_021278397.1| interactor of constitutive active ROPs 3 isoform X1 [Herrania umbratica] ref|XP_021278398.1| interactor of constitutive active ROPs 3 isoform X1 [Herrania umbratica] ref|XP_021278399.1| interactor of constitutive active ROPs 3 isoform X1 [Herrania umbratica] ref|XP_021278400.1| interactor of constitutive active ROPs 3 isoform X1 [Herrania umbratica] ref|XP_021278401.1| interactor of constitutive active ROPs 3 isoform X1 [Herrania umbratica] Length = 624 Score = 124 bits (310), Expect = 3e-29 Identities = 60/84 (71%), Positives = 71/84 (84%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAG+NG+ MERTGS+DSHY +P TGK+SSPYA+D+D Sbjct: 542 AELRRLKVQSDQWRKAAEAAAAMLSAGHNGKFMERTGSLDSHY-NPVTGKVSSPYAEDMD 600 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 601 DDLLKKKNGNMLKKIGVLWKKPQK 624 >ref|XP_022756681.1| interactor of constitutive active ROPs 3-like [Durio zibethinus] ref|XP_022756682.1| interactor of constitutive active ROPs 3-like [Durio zibethinus] Length = 624 Score = 120 bits (301), Expect = 4e-28 Identities = 58/84 (69%), Positives = 71/84 (84%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQ+DQW K AMLSAGNNG+ +ERTGS+DS+Y +P TGK+SSPYA+D+D Sbjct: 542 AELRRLKVQTDQWRKAAEAAAAMLSAGNNGKFIERTGSLDSNY-NPVTGKVSSPYAEDMD 600 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 601 DDLLKKKNGNMLKKIGVLWKKPQK 624 >ref|XP_022731952.1| interactor of constitutive active ROPs 3-like [Durio zibethinus] ref|XP_022731953.1| interactor of constitutive active ROPs 3-like [Durio zibethinus] ref|XP_022731954.1| interactor of constitutive active ROPs 3-like [Durio zibethinus] ref|XP_022731955.1| interactor of constitutive active ROPs 3-like [Durio zibethinus] Length = 624 Score = 120 bits (300), Expect = 6e-28 Identities = 58/84 (69%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ +ERTGS+DS+Y +P TGK+SSPY +D+D Sbjct: 542 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFIERTGSLDSNY-NPVTGKVSSPYTEDMD 600 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 601 DDLLKKKNVNMLKKIGVLWKKPQK 624 >ref|XP_022875087.1| interactor of constitutive active ROPs 3-like [Olea europaea var. sylvestris] ref|XP_022875088.1| interactor of constitutive active ROPs 3-like [Olea europaea var. sylvestris] ref|XP_022875089.1| interactor of constitutive active ROPs 3-like [Olea europaea var. sylvestris] Length = 640 Score = 119 bits (298), Expect = 1e-27 Identities = 59/83 (71%), Positives = 69/83 (83%) Frame = -2 Query: 589 ELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLDE 410 +LRRLKVQSDQW K +ML GNNG++MERTGSMDS+Y SPR GKISSP A+++DE Sbjct: 559 DLRRLKVQSDQWRKAAEAAASMLPVGNNGKLMERTGSMDSNY-SPRMGKISSPCAENVDE 617 Query: 409 DLMKKKNANMLRRFGVLWKKQQK 341 DL+KKKNANML+R GVLWKK QK Sbjct: 618 DLLKKKNANMLKRLGVLWKKPQK 640 >ref|XP_015582753.1| PREDICTED: interactor of constitutive active ROPs 3 [Ricinus communis] ref|XP_015582754.1| PREDICTED: interactor of constitutive active ROPs 3 [Ricinus communis] ref|XP_015582755.1| PREDICTED: interactor of constitutive active ROPs 3 [Ricinus communis] Length = 617 Score = 118 bits (296), Expect = 2e-27 Identities = 58/84 (69%), Positives = 68/84 (80%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DS Y +P TG+I SPY +D+D Sbjct: 535 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGRFMERTGSLDSSY-NPATGRIGSPYNEDMD 593 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 594 DDLLKKKNGNMLKKIGVLWKKPQK 617 >gb|EEF30117.1| ATP binding protein, putative [Ricinus communis] Length = 618 Score = 118 bits (296), Expect = 2e-27 Identities = 58/84 (69%), Positives = 68/84 (80%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DS Y +P TG+I SPY +D+D Sbjct: 536 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGRFMERTGSLDSSY-NPATGRIGSPYNEDMD 594 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN NML++ GVLWKK QK Sbjct: 595 DDLLKKKNGNMLKKIGVLWKKPQK 618 >gb|OMO71202.1| putative ATP binding protein [Corchorus capsularis] Length = 621 Score = 118 bits (296), Expect = 2e-27 Identities = 57/84 (67%), Positives = 70/84 (83%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DS+Y +P TGK+ SP+A+D+D Sbjct: 539 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSNY-NPVTGKVGSPFAEDID 597 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN N+L++ GVLWKK QK Sbjct: 598 DDLLKKKNGNVLKKIGVLWKKPQK 621 >gb|OMO77247.1| putative ATP binding protein [Corchorus olitorius] Length = 623 Score = 118 bits (296), Expect = 2e-27 Identities = 57/84 (67%), Positives = 69/84 (82%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K AMLSAGNNG+ MERTGS+DS+Y +P TGK+ SPY +D+D Sbjct: 541 AELRRLKVQSDQWRKAAEAAAAMLSAGNNGKFMERTGSLDSNY-NPVTGKVGSPYGEDID 599 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 +DL+KKKN N+L++ GVLWKK QK Sbjct: 600 DDLLKKKNGNVLKKIGVLWKKPQK 623 >ref|XP_012485254.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] ref|XP_012485255.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] ref|XP_012485256.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] ref|XP_012485257.1| PREDICTED: interactor of constitutive active ROPs 3-like [Gossypium raimondii] gb|KJB35596.1| hypothetical protein B456_006G121200 [Gossypium raimondii] gb|KJB35597.1| hypothetical protein B456_006G121200 [Gossypium raimondii] gb|KJB35598.1| hypothetical protein B456_006G121200 [Gossypium raimondii] Length = 624 Score = 118 bits (296), Expect = 2e-27 Identities = 58/84 (69%), Positives = 68/84 (80%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K +MLSAGNNG+ MERTGS+DS+Y +P GK+S PYA+D D Sbjct: 542 AELRRLKVQSDQWRKAAEAAASMLSAGNNGKFMERTGSLDSNY-NPVKGKVSPPYAEDSD 600 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 EDL+KKKN NML++ GVLWKK QK Sbjct: 601 EDLLKKKNGNMLKKIGVLWKKPQK 624 >gb|PPD91339.1| hypothetical protein GOBAR_DD11739 [Gossypium barbadense] Length = 658 Score = 118 bits (296), Expect = 2e-27 Identities = 58/84 (69%), Positives = 68/84 (80%) Frame = -2 Query: 592 AELRRLKVQSDQWMKXXXXXXAMLSAGNNGQIMERTGSMDSHYGSPRTGKISSPYADDLD 413 AELRRLKVQSDQW K +MLSAGNNG+ MERTGS+DS+Y +P GK+S PYA+D D Sbjct: 576 AELRRLKVQSDQWRKAAEAAASMLSAGNNGKFMERTGSLDSNY-NPVKGKVSPPYAEDSD 634 Query: 412 EDLMKKKNANMLRRFGVLWKKQQK 341 EDL+KKKN NML++ GVLWKK QK Sbjct: 635 EDLLKKKNGNMLKKIGVLWKKPQK 658