BLASTX nr result
ID: Rehmannia31_contig00004632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00004632 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17526.1| putative membrane protein [Handroanthus impetigin... 104 9e-24 ref|XP_022872527.1| cytochrome b561 and DOMON domain-containing ... 100 3e-22 ref|XP_012830163.1| PREDICTED: cytochrome b561 and DOMON domain-... 95 2e-20 ref|XP_011100520.1| cytochrome b561 and DOMON domain-containing ... 94 3e-20 ref|XP_011100613.1| cytochrome b561 and DOMON domain-containing ... 89 2e-18 ref|XP_017253617.1| PREDICTED: cytochrome b561 and DOMON domain-... 88 6e-18 ref|XP_019261049.1| PREDICTED: cytochrome b561 and DOMON domain-... 87 8e-18 ref|XP_009615152.1| PREDICTED: cytochrome b561 and DOMON domain-... 86 2e-17 ref|NP_001305527.1| cytochrome b561 and DOMON domain-containing ... 86 2e-17 gb|PHU12060.1| Cytochrome and DOMON domain-containing protein [C... 86 2e-17 gb|PHT43100.1| Cytochrome and DOMON domain-containing protein [C... 86 2e-17 ref|XP_016580556.1| PREDICTED: cytochrome b561 and DOMON domain-... 86 2e-17 ref|XP_009774831.1| PREDICTED: cytochrome b561 and DOMON domain-... 84 1e-16 ref|XP_016446312.1| PREDICTED: cytochrome b561 and DOMON domain-... 84 1e-16 ref|XP_015076923.1| PREDICTED: cytochrome b561 and DOMON domain-... 83 3e-16 ref|XP_004240164.1| PREDICTED: cytochrome b561 and DOMON domain-... 83 3e-16 emb|CDP18260.1| unnamed protein product [Coffea canephora] 83 3e-16 ref|XP_015158758.1| PREDICTED: cytochrome b561 and DOMON domain-... 80 4e-16 ref|XP_009589711.1| PREDICTED: cytochrome b561 and DOMON domain-... 80 4e-16 ref|XP_012841681.1| PREDICTED: cytochrome b561 and DOMON domain-... 81 6e-16 >gb|PIN17526.1| putative membrane protein [Handroanthus impetiginosus] Length = 573 Score = 104 bits (260), Expect = 9e-24 Identities = 45/68 (66%), Positives = 57/68 (83%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANH 327 MG PKTVL S F II LF+TSYAQ+CS +TF+NNN Y +C++LPAL+SFLHWNY+ +N Sbjct: 1 MGNFPKTVLFSSFFIIYLFSTSYAQNCSSFTFSNNNNYVSCSTLPALNSFLHWNYNPSNR 60 Query: 328 TVDIAYRH 351 T+D+AYRH Sbjct: 61 TIDVAYRH 68 Score = 68.9 bits (167), Expect = 4e-11 Identities = 26/43 (60%), Positives = 35/43 (81%) Frame = +1 Query: 223 SCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAYRH 351 +C Y F+NNN Y +C+ LPAL+SFLHWNY +N+T+D+AYRH Sbjct: 209 NCPSYRFSNNNNYVSCSPLPALNSFLHWNYSPSNNTIDVAYRH 251 >ref|XP_022872527.1| cytochrome b561 and DOMON domain-containing protein At4g17280-like [Olea europaea var. sylvestris] Length = 583 Score = 100 bits (249), Expect = 3e-22 Identities = 44/68 (64%), Positives = 53/68 (77%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANH 327 M KTVL SC I ++SYAQ+CS+Y F+NNNLYT CNSLP L+S LHW+YHQ+NH Sbjct: 1 MDKFVKTVLFSCLLISLFASSSYAQNCSEYRFSNNNLYTTCNSLPVLNSSLHWSYHQSNH 60 Query: 328 TVDIAYRH 351 +VDIAYRH Sbjct: 61 SVDIAYRH 68 Score = 77.4 bits (189), Expect = 4e-14 Identities = 31/44 (70%), Positives = 41/44 (93%) Frame = +1 Query: 220 QSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAYRH 351 QSCS+Y F+NN LY++CN+LP L+SFLHW+YHQ+NH++DIAYRH Sbjct: 211 QSCSEYRFSNN-LYSSCNNLPVLNSFLHWSYHQSNHSIDIAYRH 253 >ref|XP_012830163.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530 [Erythranthe guttata] gb|EYU43190.1| hypothetical protein MIMGU_mgv1a007398mg [Erythranthe guttata] Length = 409 Score = 94.7 bits (234), Expect = 2e-20 Identities = 44/65 (67%), Positives = 51/65 (78%), Gaps = 2/65 (3%) Frame = +1 Query: 163 KTVLLSCFSIICLFA-TSYAQ-SCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVD 336 K V+ + F II LF +SY Q SCS+YTFTNNN+YT CN LP L+SFLHWNYHQ N T+D Sbjct: 6 KIVMFAFFLIISLFTPSSYGQRSCSNYTFTNNNIYTTCNDLPVLNSFLHWNYHQTNRTID 65 Query: 337 IAYRH 351 IAYRH Sbjct: 66 IAYRH 70 >ref|XP_011100520.1| cytochrome b561 and DOMON domain-containing protein At5g47530-like [Sesamum indicum] Length = 392 Score = 94.0 bits (232), Expect = 3e-20 Identities = 44/61 (72%), Positives = 53/61 (86%), Gaps = 1/61 (1%) Frame = +1 Query: 169 VLLSCFSIICLFATSY-AQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAY 345 VLL+ F II L A+S AQ+CSDY F+NNN+Y ACNSLPAL+SFLHWNYHQ++HTVD+AY Sbjct: 9 VLLASFLIIFLTASSSRAQNCSDYRFSNNNIYKACNSLPALNSFLHWNYHQSSHTVDLAY 68 Query: 346 R 348 R Sbjct: 69 R 69 >ref|XP_011100613.1| cytochrome b561 and DOMON domain-containing protein At5g35735-like [Sesamum indicum] Length = 393 Score = 89.0 bits (219), Expect = 2e-18 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = +1 Query: 169 VLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAYR 348 VL+S F LFA S AQ CS YTF+NN +YTACN LPALSSF+HWNYHQAN+++DIAYR Sbjct: 10 VLISSF---LLFAPSQAQDCSAYTFSNN-VYTACNRLPALSSFIHWNYHQANNSIDIAYR 65 Query: 349 H 351 H Sbjct: 66 H 66 >ref|XP_017253617.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g35735-like [Daucus carota subsp. sativus] gb|KZM95986.1| hypothetical protein DCAR_019228 [Daucus carota subsp. sativus] Length = 409 Score = 87.8 bits (216), Expect = 6e-18 Identities = 37/68 (54%), Positives = 50/68 (73%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANH 327 M L KT++ SC + C+FA+S AQ C +Y F +NNL++ C+SLP ++FLHW YH ANH Sbjct: 1 MDRLQKTLVFSCV-LFCVFASSLAQDCKNYQFKSNNLFSTCSSLPVQNAFLHWTYHAANH 59 Query: 328 TVDIAYRH 351 T DIA+RH Sbjct: 60 TADIAFRH 67 >ref|XP_019261049.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana attenuata] gb|OIT38734.1| cytochrome b561 and domon domain-containing protein [Nicotiana attenuata] Length = 401 Score = 87.4 bits (215), Expect = 8e-18 Identities = 35/62 (56%), Positives = 48/62 (77%) Frame = +1 Query: 166 TVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAY 345 T L+ ++ LF ++YAQ+CS + F+NNN+++ CN LP L+SFLHW YH ANHTVD+AY Sbjct: 7 TSLVFSSILLTLFTSTYAQNCSSHRFSNNNIFSTCNPLPVLNSFLHWTYHSANHTVDLAY 66 Query: 346 RH 351 RH Sbjct: 67 RH 68 >ref|XP_009615152.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana tomentosiformis] Length = 401 Score = 86.3 bits (212), Expect = 2e-17 Identities = 35/62 (56%), Positives = 46/62 (74%) Frame = +1 Query: 166 TVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAY 345 T L+ ++ LF ++YAQ+CS + F NNN++ CN LP L+SFLHW YH ANHTVD+AY Sbjct: 7 TSLVFSSILLTLFTSTYAQNCSSHLFRNNNIFATCNPLPVLNSFLHWTYHSANHTVDLAY 66 Query: 346 RH 351 RH Sbjct: 67 RH 68 >ref|NP_001305527.1| cytochrome b561 and DOMON domain-containing protein At5g47530-like precursor [Solanum tuberosum] emb|CAC37356.1| putative membrane protein [Solanum tuberosum] Length = 402 Score = 86.3 bits (212), Expect = 2e-17 Identities = 36/66 (54%), Positives = 47/66 (71%) Frame = +1 Query: 154 MLPKTVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTV 333 +L ++L ++ LF SY Q+CS + FTNNNL++ CN LP L+SFLHW YH NHTV Sbjct: 5 LLTSNLVLFSSILLTLFTFSYGQNCSTHQFTNNNLFSTCNPLPVLNSFLHWTYHPDNHTV 64 Query: 334 DIAYRH 351 D+AYRH Sbjct: 65 DLAYRH 70 >gb|PHU12060.1| Cytochrome and DOMON domain-containing protein [Capsicum chinense] Length = 403 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/71 (57%), Positives = 51/71 (71%), Gaps = 3/71 (4%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATS-YAQS--CSDYTFTNNNLYTACNSLPALSSFLHWNYHQ 318 M L +T+L S F ++ LFATS YAQ+ CS + F NN L+ CN LP L+SFLHW+YH Sbjct: 1 MDRLLRTLLFSSFLLLSLFATSSYAQTQNCSSFAFRNNQLFATCNPLPVLNSFLHWSYHP 60 Query: 319 ANHTVDIAYRH 351 NHTVD+AYRH Sbjct: 61 DNHTVDLAYRH 71 >gb|PHT43100.1| Cytochrome and DOMON domain-containing protein [Capsicum baccatum] Length = 403 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/71 (57%), Positives = 51/71 (71%), Gaps = 3/71 (4%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATS-YAQS--CSDYTFTNNNLYTACNSLPALSSFLHWNYHQ 318 M L +T+L S F ++ LFATS YAQ+ CS + F NN L+ CN LP L+SFLHW+YH Sbjct: 1 MDRLLRTLLFSSFLLLSLFATSSYAQTQNCSSFAFRNNQLFATCNPLPVLNSFLHWSYHP 60 Query: 319 ANHTVDIAYRH 351 NHTVD+AYRH Sbjct: 61 DNHTVDLAYRH 71 >ref|XP_016580556.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Capsicum annuum] gb|PHT76302.1| Cytochrome and DOMON domain-containing protein [Capsicum annuum] Length = 403 Score = 86.3 bits (212), Expect = 2e-17 Identities = 41/71 (57%), Positives = 51/71 (71%), Gaps = 3/71 (4%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATS-YAQS--CSDYTFTNNNLYTACNSLPALSSFLHWNYHQ 318 M L +T+L S F ++ LFATS YAQ+ CS + F NN L+ CN LP L+SFLHW+YH Sbjct: 1 MDRLLRTLLFSSFLLLSLFATSSYAQTQNCSSFAFRNNQLFATCNPLPVLNSFLHWSYHP 60 Query: 319 ANHTVDIAYRH 351 NHTVD+AYRH Sbjct: 61 DNHTVDLAYRH 71 >ref|XP_009774831.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana sylvestris] ref|XP_016474633.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana tabacum] Length = 399 Score = 84.3 bits (207), Expect = 1e-16 Identities = 34/62 (54%), Positives = 46/62 (74%) Frame = +1 Query: 166 TVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAY 345 T L+ ++ LF ++YAQ+CS + F+NNN++ CN LP L+S LHW YH ANHTVD+AY Sbjct: 7 TSLVFSSILLTLFTSTYAQNCSSHRFSNNNIFATCNPLPVLNSVLHWTYHSANHTVDLAY 66 Query: 346 RH 351 RH Sbjct: 67 RH 68 >ref|XP_016446312.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Nicotiana tabacum] Length = 401 Score = 84.3 bits (207), Expect = 1e-16 Identities = 34/62 (54%), Positives = 45/62 (72%) Frame = +1 Query: 166 TVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAY 345 T L+ ++ LF ++YAQ+CS + F NNN++ CN LP L+ FLHW YH ANHTVD+AY Sbjct: 7 TSLVFSSILLTLFTSTYAQNCSSHLFRNNNIFATCNPLPVLNCFLHWTYHSANHTVDLAY 66 Query: 346 RH 351 RH Sbjct: 67 RH 68 >ref|XP_015076923.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Solanum pennellii] Length = 401 Score = 83.2 bits (204), Expect = 3e-16 Identities = 34/66 (51%), Positives = 47/66 (71%) Frame = +1 Query: 154 MLPKTVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTV 333 +L ++L ++ LF SY Q+CS + FTNNN+++ CN LP L+SFLHW Y+ NHTV Sbjct: 5 LLTSNLVLFSSILLTLFTFSYGQNCSTHQFTNNNIFSTCNPLPVLNSFLHWTYYPDNHTV 64 Query: 334 DIAYRH 351 D+AYRH Sbjct: 65 DLAYRH 70 >ref|XP_004240164.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530 [Solanum lycopersicum] Length = 401 Score = 83.2 bits (204), Expect = 3e-16 Identities = 34/66 (51%), Positives = 47/66 (71%) Frame = +1 Query: 154 MLPKTVLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTV 333 +L ++L ++ LF SY Q+CS + FTNNN+++ CN LP L+SFLHW Y+ NHTV Sbjct: 5 LLTSNLVLFSSILLTLFTFSYGQNCSTHQFTNNNIFSTCNPLPVLNSFLHWTYYPDNHTV 64 Query: 334 DIAYRH 351 D+AYRH Sbjct: 65 DLAYRH 70 >emb|CDP18260.1| unnamed protein product [Coffea canephora] Length = 404 Score = 83.2 bits (204), Expect = 3e-16 Identities = 36/61 (59%), Positives = 43/61 (70%) Frame = +1 Query: 169 VLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAYR 348 +L S+I L TS Q+CS Y F NN++ C SLP L+SFLHWNYH +NHTVDIAYR Sbjct: 10 ILSILISLISLTKTSAQQNCSSYKFNTNNIFATCISLPVLNSFLHWNYHSSNHTVDIAYR 69 Query: 349 H 351 H Sbjct: 70 H 70 >ref|XP_015158758.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g35735-like [Solanum tuberosum] Length = 221 Score = 80.5 bits (197), Expect = 4e-16 Identities = 37/70 (52%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFATSYAQS--CSDYTFTNNNLYTACNSLPALSSFLHWNYHQA 321 M L T+L S I LF+TSY Q+ CS + F NN ++ CN+LP L+S LHW+YH Sbjct: 1 MNKLLTTLLFSSILISTLFSTSYGQNQNCSAFAFRNNQIFATCNALPLLNSVLHWSYHPD 60 Query: 322 NHTVDIAYRH 351 NHTVD+AYRH Sbjct: 61 NHTVDLAYRH 70 >ref|XP_009589711.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g35735-like [Nicotiana tomentosiformis] Length = 203 Score = 80.1 bits (196), Expect = 4e-16 Identities = 39/71 (54%), Positives = 48/71 (67%), Gaps = 3/71 (4%) Frame = +1 Query: 148 MGMLPKTVLLSCFSIICLFAT-SYAQS--CSDYTFTNNNLYTACNSLPALSSFLHWNYHQ 318 M L KT+L S F ++ LF+T SYAQ+ CS + F NN + CN LP L+S LHW YH Sbjct: 1 MDRLVKTLLFSSFLLLSLFSTTSYAQTQNCSAFAFRNNQNFATCNPLPLLNSVLHWTYHS 60 Query: 319 ANHTVDIAYRH 351 NHTVD+AYRH Sbjct: 61 DNHTVDLAYRH 71 >ref|XP_012841681.1| PREDICTED: cytochrome b561 and DOMON domain-containing protein At5g47530-like [Erythranthe guttata] Length = 300 Score = 81.3 bits (199), Expect = 6e-16 Identities = 32/61 (52%), Positives = 47/61 (77%) Frame = +1 Query: 169 VLLSCFSIICLFATSYAQSCSDYTFTNNNLYTACNSLPALSSFLHWNYHQANHTVDIAYR 348 +++ + LF +S +Q+CS+YTF +N Y AC +LP L+SFLHWNY+++NH+VDIAYR Sbjct: 6 IIIFFMFVSSLFVSSSSQNCSNYTFRDNKTYAACKTLPVLNSFLHWNYYESNHSVDIAYR 65 Query: 349 H 351 H Sbjct: 66 H 66