BLASTX nr result
ID: Rehmannia30_contig00035252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00035252 (700 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088882.1| VQ motif-containing protein 17-like [Sesamum... 66 6e-10 >ref|XP_011088882.1| VQ motif-containing protein 17-like [Sesamum indicum] Length = 157 Score = 66.2 bits (160), Expect = 6e-10 Identities = 31/39 (79%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 NAFLNFWGDVDGFFQDMNEFPLHSLR-SQINTYGEMSLC 115 NAFL+FWGDVDGFF DMNEFPL S R SQ NT+GEM LC Sbjct: 119 NAFLSFWGDVDGFFLDMNEFPLLSFRPSQFNTFGEMPLC 157