BLASTX nr result
ID: Rehmannia30_contig00035040
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00035040 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855480.1| PREDICTED: uncharacterized protein LOC105974... 45 3e-06 gb|EOY06958.1| Uncharacterized protein TCM_021520 [Theobroma cacao] 40 7e-06 >ref|XP_012855480.1| PREDICTED: uncharacterized protein LOC105974867 [Erythranthe guttata] Length = 1393 Score = 44.7 bits (104), Expect(2) = 3e-06 Identities = 18/55 (32%), Positives = 38/55 (69%), Gaps = 2/55 (3%) Frame = +3 Query: 108 NHDKFLYNEHRVSILALLEPTTSPFL--FFCKKIGFDHVVSNMSNKIWVSWKNDW 266 +H +++ +HRV++L + EP T F+ ++C+++GF +SN + KIW+ W +++ Sbjct: 20 SHLRYICRQHRVNLLVISEPMTE-FVHDYYCRRLGFVAGLSNCAGKIWIFWDHNF 73 Score = 33.9 bits (76), Expect(2) = 3e-06 Identities = 18/38 (47%), Positives = 19/38 (50%) Frame = +2 Query: 365 RMERRELWVDLRAFAPTCVDFP*FIGGDFNNFLHPEER 478 R ERR LW R T D P GGDFN+ L ER Sbjct: 109 RSERRVLWNSFRDIFETIGDTPWISGGDFNSILLESER 146 >gb|EOY06958.1| Uncharacterized protein TCM_021520 [Theobroma cacao] Length = 754 Score = 40.4 bits (93), Expect(2) = 7e-06 Identities = 18/45 (40%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = +3 Query: 135 HRVSILALLEP--TTSPFLFFCKKIGFDHVVSNMSNKIWVSWKND 263 H+V +L +LEP TS + +++GFD+ +SN S+KIW+ N+ Sbjct: 228 HKVKLLVVLEPMVNTSRINYIKRRLGFDNALSNCSHKIWLFCSNE 272 Score = 37.0 bits (84), Expect(2) = 7e-06 Identities = 17/39 (43%), Positives = 27/39 (69%) Frame = +2 Query: 365 RMERRELWVDLRAFAPTCVDFP*FIGGDFNNFLHPEERV 481 R+ERRELW +LR + + + P +GGDFN+ + +ER+ Sbjct: 309 RLERRELWSNLRIISDS-MQAPWLVGGDFNSIVSCDERL 346