BLASTX nr result
ID: Rehmannia30_contig00034814
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00034814 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019171908.1| PREDICTED: uncharacterized protein LOC109167... 39 5e-06 >ref|XP_019171908.1| PREDICTED: uncharacterized protein LOC109167340 [Ipomoea nil] Length = 396 Score = 39.3 bits (90), Expect(2) = 5e-06 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = +2 Query: 206 LTYWLVENFNALSSELIFEDGRCIHIEREDVGRVMGFPDGDVIEK---KKKSGKCALYDE 376 L YW++ +++ ++ +L + + +DV V+G P G + K K+ S AL++E Sbjct: 110 LCYWILTHYDGMAGKLTLHTNETLDVTEDDVEAVLGLPRGPLEIKYKGKRISSTNALFNE 169 Query: 377 WK 382 WK Sbjct: 170 WK 171 Score = 38.5 bits (88), Expect(2) = 5e-06 Identities = 17/33 (51%), Positives = 24/33 (72%) Frame = +3 Query: 99 VIVDALRALKPAQKSAVIEMGFGSLFDLKIDDF 197 ++VDA+ P Q++AV EMGFGS+ +LKI F Sbjct: 74 MLVDAIAKFSPEQQAAVREMGFGSILNLKIKQF 106