BLASTX nr result
ID: Rehmannia30_contig00033819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033819 (607 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHU11899.1| hypothetical protein BC332_18829 [Capsicum chinense] 43 7e-07 ref|XP_016546217.1| PREDICTED: uncharacterized protein LOC107846... 46 9e-06 >gb|PHU11899.1| hypothetical protein BC332_18829 [Capsicum chinense] Length = 254 Score = 43.1 bits (100), Expect(2) = 7e-07 Identities = 18/39 (46%), Positives = 27/39 (69%) Frame = -1 Query: 379 RYRIQFEVVDDSGNIQLLCWDRDCESLIGKSCSRLKSEL 263 RY++Q V+D +G I L WDR+ LIGKS ++LK ++ Sbjct: 130 RYKLQVRVMDGTGFISLFLWDREAIKLIGKSATQLKGQI 168 Score = 38.1 bits (87), Expect(2) = 7e-07 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = -3 Query: 575 YLSCKKYPK*HTKIGEIFYCERCDTFFQTGNFRY 474 Y+ CK++PK KIG F+C++CD + +RY Sbjct: 98 YMGCKRFPKKVEKIGNKFHCKKCDRLDHSPAYRY 131 >ref|XP_016546217.1| PREDICTED: uncharacterized protein LOC107846305 [Capsicum annuum] Length = 185 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 21/45 (46%), Positives = 30/45 (66%) Frame = -1 Query: 379 RYRIQFEVVDDSGNIQLLCWDRDCESLIGKSCSRLKSELAEVYVK 245 RY++Q V+D + I LL WDR+ LIGK+ ++LK + EV VK Sbjct: 32 RYKLQVRVMDGTDFISLLLWDREATKLIGKTATQLKGHVDEVAVK 76 Score = 31.6 bits (70), Expect(2) = 9e-06 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -3 Query: 572 LSCKKYPK*HTKIGEIFYCERCDTFFQTGNFRY 474 ++CKK + K+G F+C++CD + +RY Sbjct: 1 MACKKCTRKIDKLGNKFHCKKCDRLDHSATYRY 33