BLASTX nr result
ID: Rehmannia30_contig00033766
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033766 (544 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT68651.1| hypothetical protein T459_28138 [Capsicum annuum] 107 1e-24 gb|KYP77543.1| hypothetical protein KK1_049123, partial [Cajanus... 76 3e-14 gb|EEF44144.1| conserved hypothetical protein [Ricinus communis] 67 3e-10 gb|EEF27212.1| conserved hypothetical protein, partial [Ricinus ... 55 1e-06 gb|OIV89892.1| hypothetical protein TanjilG_14030 [Lupinus angus... 57 2e-06 >gb|PHT68651.1| hypothetical protein T459_28138 [Capsicum annuum] Length = 347 Score = 107 bits (268), Expect = 1e-24 Identities = 56/67 (83%), Positives = 56/67 (83%) Frame = +2 Query: 29 KNNPSGLTPVADPNRKALDGLTASEIKKAAGPMCKTLPRESLSPMRIKKVFWQDKKETRP 208 K S LTP ADPNRKAL GL ASEIKKAAGPMCKTLPRESLS MRIKKV QDKK TRP Sbjct: 281 KPKRSNLTPRADPNRKALAGLRASEIKKAAGPMCKTLPRESLSSMRIKKVLGQDKKGTRP 340 Query: 209 LTPRDKS 229 LTPRDKS Sbjct: 341 LTPRDKS 347 >gb|KYP77543.1| hypothetical protein KK1_049123, partial [Cajanus cajan] Length = 135 Score = 75.9 bits (185), Expect = 3e-14 Identities = 39/43 (90%), Positives = 40/43 (93%) Frame = -2 Query: 216 GVKGRVSFLSCQKTFFILIGERLSRGKVLHIGPAAFFISLAVS 88 GVKGRV FLS QKT FILIGERLSRGKVLHIGPAAFFISLAV+ Sbjct: 55 GVKGRVPFLSGQKTCFILIGERLSRGKVLHIGPAAFFISLAVN 97 >gb|EEF44144.1| conserved hypothetical protein [Ricinus communis] Length = 213 Score = 67.0 bits (162), Expect = 3e-10 Identities = 34/53 (64%), Positives = 38/53 (71%) Frame = +1 Query: 157 SNENKESFLARQERNSPFDTKG*ELIAGDDLVKGIYERRFSNRVPTE*STEPN 315 + NK+SF ARQERNSPFDTK ELIAGDDLVKGIYER R + +PN Sbjct: 117 TKSNKDSFWARQERNSPFDTKRQELIAGDDLVKGIYERSAGTRWKRQRREQPN 169 >gb|EEF27212.1| conserved hypothetical protein, partial [Ricinus communis] Length = 86 Score = 54.7 bits (130), Expect = 1e-06 Identities = 24/31 (77%), Positives = 24/31 (77%) Frame = +1 Query: 37 PKRSNPRGGPQPKGARRTNGKRDKESSWPYV 129 P P GGPQPKGARRT GKRDKESSWP V Sbjct: 56 PSGLTPPGGPQPKGARRTKGKRDKESSWPLV 86 >gb|OIV89892.1| hypothetical protein TanjilG_14030 [Lupinus angustifolius] Length = 285 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/67 (50%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = -1 Query: 295 RSEPCSRTFSHRFPSPSHRQQSALIPWC--QRASFFLVLPKNFLYSHWRKTLPRQGFTHR 122 ++EP RTFSHRF SPSHR QSALIPWC + FL PK L R+ L R + Sbjct: 34 QAEPSLRTFSHRFLSPSHRLQSALIPWCGVKGRVPFLSCPKTSLI-RIRERLSRDKAKNA 92 Query: 121 ASCFLYL 101 CF YL Sbjct: 93 IGCFAYL 99