BLASTX nr result
ID: Rehmannia30_contig00033682
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033682 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16698.1| hypothetical protein CDL12_10663 [Handroanthus im... 69 4e-11 ref|XP_011075221.1| nuclear transcription factor Y subunit A-1-l... 57 2e-06 >gb|PIN16698.1| hypothetical protein CDL12_10663 [Handroanthus impetiginosus] Length = 271 Score = 69.3 bits (168), Expect = 4e-11 Identities = 34/76 (44%), Positives = 46/76 (60%) Frame = +2 Query: 32 MQHQLNKRQPHEFDAKSYILSTACSRSWHYGIGDDFIVSPNVPSRATLGMTSVYQQNACW 211 MQ Q +K++ HEFDAK Y L TA ++ W+YGIG DF +SPNV S +TL + S Q N CW Sbjct: 1 MQRQPDKKEQHEFDAKGYDLFTAGAQCWNYGIGSDF-MSPNVLSGSTLDVASANQINTCW 59 Query: 212 SGNQISEMPSSGSKNI 259 + G ++ Sbjct: 60 GSPSCESQANGGQISV 75 >ref|XP_011075221.1| nuclear transcription factor Y subunit A-1-like [Sesamum indicum] Length = 298 Score = 56.6 bits (135), Expect = 2e-06 Identities = 35/73 (47%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +2 Query: 32 MQHQLNKRQPHEFDAKSYILSTAC-SRSWHYGIGDDFIVSPNVPSRATLGMTSVYQQNAC 208 MQ Q KR EFDAK Y L S+ H GI D+F+ S NV SR+TLG+ SV Q NAC Sbjct: 1 MQQQYGKRGQREFDAKGYNLCLGTGSQDRHNGIRDNFM-SVNVLSRSTLGLNSVSQLNAC 59 Query: 209 WSGNQISEMPSSG 247 W +SG Sbjct: 60 WGNLARESQVNSG 72