BLASTX nr result
ID: Rehmannia30_contig00033615
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033615 (562 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_817244.1| ORF45d [Pinus koraiensis] >gi|29469761|gb|AAO74... 60 4e-09 gb|KMS96934.1| hypothetical protein BVRB_7g180160 [Beta vulgaris... 55 3e-07 >ref|NP_817244.1| ORF45d [Pinus koraiensis] gb|AAO74089.1| ORF45d (chloroplast) [Pinus koraiensis] Length = 45 Score = 60.1 bits (144), Expect = 4e-09 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 520 LTMCQEPDLNW*HEDFQSSALPAELSRPFPM*YP 419 LT CQEPDLNW HEDFQSSALP ELSR FP+ +P Sbjct: 8 LTSCQEPDLNWWHEDFQSSALPTELSRLFPVDHP 41 >gb|KMS96934.1| hypothetical protein BVRB_7g180160 [Beta vulgaris subsp. vulgaris] Length = 36 Score = 54.7 bits (130), Expect = 3e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 10 MSISTTMKFLVRGKSVDFKNREGSSPSIPK 99 MSI TTMKF+VRG+SVDFKNREGSSPSI K Sbjct: 1 MSILTTMKFIVRGRSVDFKNREGSSPSISK 30