BLASTX nr result
ID: Rehmannia30_contig00033450
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033450 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096475.2| uncharacterized protein LOC105175661 [Sesamu... 54 6e-06 gb|PHT90166.1| hypothetical protein T459_05279 [Capsicum annuum]... 53 9e-06 gb|PHT55723.1| hypothetical protein CQW23_04209 [Capsicum baccatum] 53 9e-06 >ref|XP_011096475.2| uncharacterized protein LOC105175661 [Sesamum indicum] Length = 201 Score = 54.3 bits (129), Expect = 6e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 398 RTMEAFIIILSVTQLVYIAAIHGAASRRRA 309 RTMEAFIIILS TQL Y+AAIHGAASRRRA Sbjct: 172 RTMEAFIIILSATQLFYLAAIHGAASRRRA 201 >gb|PHT90166.1| hypothetical protein T459_05279 [Capsicum annuum] gb|PHU25935.1| hypothetical protein BC332_04267 [Capsicum chinense] Length = 158 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 398 RTMEAFIIILSVTQLVYIAAIHGAASRR 315 RTMEAF+IILSVTQLVYIAAIHGA+SRR Sbjct: 131 RTMEAFLIILSVTQLVYIAAIHGASSRR 158 >gb|PHT55723.1| hypothetical protein CQW23_04209 [Capsicum baccatum] Length = 158 Score = 53.1 bits (126), Expect = 9e-06 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -1 Query: 398 RTMEAFIIILSVTQLVYIAAIHGAASRR 315 RTMEAF+IILSVTQLVYIAAIHGA+SRR Sbjct: 131 RTMEAFLIILSVTQLVYIAAIHGASSRR 158