BLASTX nr result
ID: Rehmannia30_contig00033436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033436 (520 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090654.1| pentatricopeptide repeat-containing protein ... 87 8e-17 gb|PIN05049.1| hypothetical protein CDL12_22413 [Handroanthus im... 80 3e-14 ref|XP_012849847.1| PREDICTED: pentatricopeptide repeat-containi... 79 5e-14 gb|PIN10166.1| hypothetical protein CDL12_17247 [Handroanthus im... 78 1e-13 emb|CBI26320.3| unnamed protein product, partial [Vitis vinifera] 76 6e-13 ref|XP_002283562.1| PREDICTED: pentatricopeptide repeat-containi... 76 6e-13 ref|XP_021692045.1| pentatricopeptide repeat-containing protein ... 75 1e-12 gb|OIT38996.1| pentatricopeptide repeat-containing protein [Nico... 73 2e-12 gb|PHT29045.1| Pentatricopeptide repeat-containing protein [Caps... 74 3e-12 gb|PHT40180.1| Pentatricopeptide repeat-containing protein [Caps... 74 5e-12 ref|XP_016547469.1| PREDICTED: pentatricopeptide repeat-containi... 74 5e-12 ref|XP_010279274.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-12 ref|XP_016505184.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-12 ref|XP_016434295.1| PREDICTED: pentatricopeptide repeat-containi... 73 7e-12 gb|OIT38995.1| pentatricopeptide repeat-containing protein [Nico... 71 8e-12 ref|XP_009611854.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-11 ref|XP_006355780.1| PREDICTED: pentatricopeptide repeat-containi... 72 2e-11 ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containi... 71 3e-11 emb|CDO98638.1| unnamed protein product [Coffea canephora] 71 4e-11 ref|XP_019254260.1| PREDICTED: pentatricopeptide repeat-containi... 69 2e-10 >ref|XP_011090654.1| pentatricopeptide repeat-containing protein At5g43790 [Sesamum indicum] ref|XP_011090655.1| pentatricopeptide repeat-containing protein At5g43790 [Sesamum indicum] Length = 598 Score = 87.4 bits (215), Expect = 8e-17 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 MRTVSPT DHPIL L+QKCKTL+T +++H QMITTGLILHTYP SRILLL Sbjct: 1 MRTVSPTSDHPILRLVQKCKTLDTFREIHAQMITTGLILHTYPASRILLL 50 >gb|PIN05049.1| hypothetical protein CDL12_22413 [Handroanthus impetiginosus] Length = 598 Score = 80.1 bits (196), Expect = 3e-14 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 M+ V P V HPI++LLQKCKTL+T KQ H QMITTGLI HTYP+SRIL+L Sbjct: 1 MQAVGPAVKHPIIDLLQKCKTLDTFKQAHAQMITTGLIRHTYPISRILIL 50 >ref|XP_012849847.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Erythranthe guttata] gb|EYU26974.1| hypothetical protein MIMGU_mgv1a024161mg [Erythranthe guttata] Length = 591 Score = 79.3 bits (194), Expect = 5e-14 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 MR +SPTV+HP+L+LL+ +TLNT+KQVH QMITT LILHTYP+SRILL Sbjct: 1 MRPISPTVNHPMLHLLETSETLNTIKQVHAQMITTALILHTYPISRILL 49 >gb|PIN10166.1| hypothetical protein CDL12_17247 [Handroanthus impetiginosus] Length = 598 Score = 78.2 bits (191), Expect = 1e-13 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 M+ V P V HPI++LLQKCKTL+T KQ H QMITTGL HTYP+SRIL+L Sbjct: 1 MQAVGPAVKHPIIDLLQKCKTLDTFKQAHAQMITTGLTRHTYPISRILIL 50 >emb|CBI26320.3| unnamed protein product, partial [Vitis vinifera] Length = 522 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 MR +P+ +HP L LL+KCKTL+TLKQVH MITTGLI HTYP+SRILL+ Sbjct: 1 MRGPNPSSNHPTLQLLEKCKTLDTLKQVHAHMITTGLIFHTYPLSRILLI 50 >ref|XP_002283562.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Vitis vinifera] Length = 590 Score = 76.3 bits (186), Expect = 6e-13 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 MR +P+ +HP L LL+KCKTL+TLKQVH MITTGLI HTYP+SRILL+ Sbjct: 1 MRGPNPSSNHPTLQLLEKCKTLDTLKQVHAHMITTGLIFHTYPLSRILLI 50 >ref|XP_021692045.1| pentatricopeptide repeat-containing protein At5g43790 [Hevea brasiliensis] Length = 599 Score = 75.1 bits (183), Expect = 1e-12 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M++ +P HPIL LLQKC+TL+TLKQ+H QMI TGL LHTYP+SR+LL Sbjct: 1 MKSPNPVFTHPILQLLQKCRTLDTLKQIHAQMIATGLALHTYPLSRLLL 49 >gb|OIT38996.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 238 Score = 72.8 bits (177), Expect = 2e-12 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M+T+ P HPI L+++CK + TLKQVH QMITTGLILHTYP+SRIL+ Sbjct: 1 MKTLGPKSAHPIFKLIEQCKNIATLKQVHAQMITTGLILHTYPLSRILI 49 >gb|PHT29045.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 537 Score = 74.3 bits (181), Expect = 3e-12 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 MRT+SP HPI L+++CK + TLKQVH MITTGLILHTYP+SRIL+ Sbjct: 1 MRTLSPKSSHPIFKLIEQCKNIATLKQVHAHMITTGLILHTYPLSRILI 49 >gb|PHT40180.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 471 Score = 73.6 bits (179), Expect = 5e-12 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 MRT+SP HPI L+++CK + TLKQVH MITTGLILHTYP+SRIL+ Sbjct: 1 MRTLSPKSAHPIFKLIEQCKNIATLKQVHAHMITTGLILHTYPLSRILI 49 >ref|XP_016547469.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Capsicum annuum] gb|PHT95635.1| Pentatricopeptide repeat-containing protein [Capsicum annuum] Length = 523 Score = 73.6 bits (179), Expect = 5e-12 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 MRT+SP HPI L+++CK + TLKQVH MITTGLILHTYP+SRIL+ Sbjct: 1 MRTLSPKSAHPIFKLIEQCKNIATLKQVHAHMITTGLILHTYPLSRILI 49 >ref|XP_010279274.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Nelumbo nucifera] Length = 596 Score = 73.2 bits (178), Expect = 7e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 M++ T +HPIL LL++C+TL TLKQVH QMIT GLILHT+P+SRILLL Sbjct: 1 MKSPKSTSNHPILLLLEECRTLKTLKQVHAQMITMGLILHTFPISRILLL 50 >ref|XP_016505184.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Nicotiana tabacum] Length = 601 Score = 73.2 bits (178), Expect = 7e-12 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M T+SP HPI L+++CK + TLKQVH QMITTGLILHTYP+SRIL+ Sbjct: 1 MNTLSPKSVHPIFKLIEQCKNIATLKQVHAQMITTGLILHTYPLSRILI 49 >ref|XP_016434295.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like [Nicotiana tabacum] Length = 706 Score = 73.2 bits (178), Expect = 7e-12 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = -3 Query: 167 IHPNRMRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 + + M+T+SP HPI L+Q+C + TLKQVH QMITTGLILHTYP+SRIL+ Sbjct: 101 LRAHHMKTLSPKSAHPIFKLIQQCINIATLKQVHAQMITTGLILHTYPLSRILI 154 >gb|OIT38995.1| pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 238 Score = 71.2 bits (173), Expect = 8e-12 Identities = 32/49 (65%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M+T+SP H I L+++CK + TLKQVH QMITTGLILHTYP+SRIL+ Sbjct: 1 MKTLSPKSAHSIFKLIEQCKNIATLKQVHAQMITTGLILHTYPLSRILI 49 >ref|XP_009611854.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Nicotiana tomentosiformis] Length = 601 Score = 72.4 bits (176), Expect = 1e-11 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M+T+SP HPI L+Q+C + TLKQVH QMITTGLILHTYP+SRIL+ Sbjct: 1 MKTLSPKSAHPIFKLIQQCINIATLKQVHAQMITTGLILHTYPLSRILI 49 >ref|XP_006355780.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Solanum tuberosum] Length = 602 Score = 72.0 bits (175), Expect = 2e-11 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M T+SP HPI L+++CK + TLKQVH QMITTGLI HTYP+SRIL+ Sbjct: 1 MNTLSPKSAHPIFKLIEQCKNIATLKQVHAQMITTGLIFHTYPLSRILI 49 >ref|XP_004244755.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790 [Solanum lycopersicum] Length = 602 Score = 71.2 bits (173), Expect = 3e-11 Identities = 31/49 (63%), Positives = 39/49 (79%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILL 6 M T+SP HPI ++++CK + TLKQVH QMITTGLI HTYP+SRIL+ Sbjct: 1 MNTLSPKSAHPIFKIIEQCKNIATLKQVHAQMITTGLIFHTYPLSRILI 49 >emb|CDO98638.1| unnamed protein product [Coffea canephora] Length = 501 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -3 Query: 140 SPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 +P +HPIL LL CKTLN+L Q+H QMITTGLILHTYP+SRI+L+ Sbjct: 3 TPLKNHPILQLLYGCKTLNSLLQIHAQMITTGLILHTYPLSRIILV 48 >ref|XP_019254260.1| PREDICTED: pentatricopeptide repeat-containing protein At5g43790-like isoform X4 [Nicotiana attenuata] Length = 551 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/50 (60%), Positives = 41/50 (82%) Frame = -3 Query: 152 MRTVSPTVDHPILNLLQKCKTLNTLKQVHVQMITTGLILHTYPVSRILLL 3 M+++SP HPI L+++CK + TLKQVH Q+I +GLILHTYP+SRIL+L Sbjct: 12 MKSLSPKSAHPIFKLIEQCKNIATLKQVHAQVIISGLILHTYPLSRILIL 61