BLASTX nr result
ID: Rehmannia30_contig00031935
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031935 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIS97892.1| hypothetical protein A4A49_27396 [Nicotiana atten... 54 9e-07 >gb|OIS97892.1| hypothetical protein A4A49_27396 [Nicotiana attenuata] Length = 79 Score = 53.5 bits (127), Expect = 9e-07 Identities = 26/52 (50%), Positives = 35/52 (67%) Frame = -1 Query: 389 ESEIRIRAKFCSLFLKNLSTVPYNAVLNGDGHKKLHLVARRLVPEGPNPLHN 234 ++E RI+ KF S F + T+P+ A K+LH+V+RRLVP GPNPLHN Sbjct: 33 DNEERIKVKFYSTFFRYFKTIPHYAQ-----GKQLHIVSRRLVPSGPNPLHN 79