BLASTX nr result
ID: Rehmannia30_contig00031736
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031736 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN12344.1| Glycosyltransferase [Handroanthus impetiginosus] 65 2e-09 ref|XP_011091471.1| dolichyl-phosphate beta-glucosyltransferase ... 65 2e-09 ref|XP_022880150.1| dolichyl-phosphate beta-glucosyltransferase-... 64 2e-09 ref|XP_022880136.1| dolichyl-phosphate beta-glucosyltransferase-... 64 3e-09 gb|KCW65535.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus g... 63 5e-09 gb|OWM70057.1| hypothetical protein CDL15_Pgr025906 [Punica gran... 63 6e-09 gb|KDO67620.1| hypothetical protein CISIN_1g019818mg [Citrus sin... 62 8e-09 gb|KCW65534.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus g... 63 8e-09 ref|XP_010067407.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 63 9e-09 gb|PNT22928.1| hypothetical protein POPTR_008G055700v3 [Populus ... 62 9e-09 ref|XP_022746385.1| dolichyl-phosphate beta-glucosyltransferase-... 62 9e-09 gb|EYU33197.1| hypothetical protein MIMGU_mgv1a025143mg, partial... 62 1e-08 ref|XP_022746384.1| dolichyl-phosphate beta-glucosyltransferase-... 62 1e-08 ref|XP_011029377.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 62 1e-08 ref|XP_012842511.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 62 1e-08 ref|XP_022746383.1| dolichyl-phosphate beta-glucosyltransferase-... 62 1e-08 ref|XP_022765169.1| dolichyl-phosphate beta-glucosyltransferase-... 62 1e-08 ref|XP_010253173.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 62 1e-08 ref|XP_002312095.1| glycosyl transferase family 2 family protein... 62 1e-08 ref|XP_010253172.1| PREDICTED: dolichyl-phosphate beta-glucosylt... 62 1e-08 >gb|PIN12344.1| Glycosyltransferase [Handroanthus impetiginosus] Length = 333 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGALDETLNYL+ER+ KDKSFSYEV Sbjct: 75 YNEEHRLPGALDETLNYLQERSAKDKSFSYEV 106 >ref|XP_011091471.1| dolichyl-phosphate beta-glucosyltransferase [Sesamum indicum] Length = 333 Score = 64.7 bits (156), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGALDETLNYL+ERA +DKSFSYEV Sbjct: 73 YNEEHRLPGALDETLNYLQERAARDKSFSYEV 104 >ref|XP_022880150.1| dolichyl-phosphate beta-glucosyltransferase-like [Olea europaea var. sylvestris] Length = 274 Score = 63.9 bits (154), Expect = 2e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGALDETLNYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGALDETLNYLQQRAEKDKSFSYEV 106 >ref|XP_022880136.1| dolichyl-phosphate beta-glucosyltransferase-like [Olea europaea var. sylvestris] Length = 335 Score = 63.9 bits (154), Expect = 3e-09 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGALDETLNYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGALDETLNYLQQRAEKDKSFSYEV 106 >gb|KCW65535.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus grandis] Length = 243 Score = 62.8 bits (151), Expect = 5e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGA+DET+NYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGAIDETMNYLQKRAAKDKSFSYEV 106 >gb|OWM70057.1| hypothetical protein CDL15_Pgr025906 [Punica granatum] Length = 335 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGA+DET+NYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGAIDETMNYLQQRAAKDKSFSYEV 106 >gb|KDO67620.1| hypothetical protein CISIN_1g019818mg [Citrus sinensis] Length = 229 Score = 62.0 bits (149), Expect = 8e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDETLNYL++RA KDKSF+YEV Sbjct: 75 FNEEHRLPGALDETLNYLQQRAAKDKSFTYEV 106 >gb|KCW65534.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus grandis] Length = 325 Score = 62.8 bits (151), Expect = 8e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGA+DET+NYL++RA KDKSFSYEV Sbjct: 65 YNEEHRLPGAIDETMNYLQKRAAKDKSFSYEV 96 >ref|XP_010067407.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Eucalyptus grandis] gb|KCW65533.1| hypothetical protein EUGRSUZ_G02933 [Eucalyptus grandis] Length = 335 Score = 62.8 bits (151), Expect = 9e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPGA+DET+NYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGAIDETMNYLQKRAAKDKSFSYEV 106 >gb|PNT22928.1| hypothetical protein POPTR_008G055700v3 [Populus trichocarpa] Length = 276 Score = 62.4 bits (150), Expect = 9e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL+ERA KDKSF+YEV Sbjct: 75 FNEEHRLPGALDETINYLQERAAKDKSFTYEV 106 >ref|XP_022746385.1| dolichyl-phosphate beta-glucosyltransferase-like isoform X3 [Durio zibethinus] Length = 285 Score = 62.4 bits (150), Expect = 9e-09 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL++RA KDKSFSYEV Sbjct: 75 FNEEHRLPGALDETMNYLQQRAAKDKSFSYEV 106 >gb|EYU33197.1| hypothetical protein MIMGU_mgv1a025143mg, partial [Erythranthe guttata] Length = 304 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPG LDETLNYL+ERA KDKSF+YEV Sbjct: 76 YNEEHRLPGYLDETLNYLQERASKDKSFTYEV 107 >ref|XP_022746384.1| dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Durio zibethinus] Length = 315 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL++RA KDKSFSYEV Sbjct: 75 FNEEHRLPGALDETMNYLQQRAAKDKSFSYEV 106 >ref|XP_011029377.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like [Populus euphratica] Length = 332 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL+ERA KDKSF+YEV Sbjct: 75 FNEEHRLPGALDETINYLQERAAKDKSFTYEV 106 >ref|XP_012842511.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase [Erythranthe guttata] Length = 333 Score = 62.4 bits (150), Expect = 1e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPG LDETLNYL+ERA KDKSF+YEV Sbjct: 76 YNEEHRLPGYLDETLNYLQERASKDKSFTYEV 107 >ref|XP_022746383.1| dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Durio zibethinus] Length = 334 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL++RA KDKSFSYEV Sbjct: 75 FNEEHRLPGALDETMNYLQQRAAKDKSFSYEV 106 >ref|XP_022765169.1| dolichyl-phosphate beta-glucosyltransferase-like [Durio zibethinus] ref|XP_022765170.1| dolichyl-phosphate beta-glucosyltransferase-like [Durio zibethinus] Length = 335 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL++RA KDKSFSYEV Sbjct: 75 FNEEHRLPGALDETMNYLQQRAAKDKSFSYEV 106 >ref|XP_010253173.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X2 [Nelumbo nucifera] Length = 335 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPG LDET+NYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGTLDETMNYLQQRAAKDKSFSYEV 106 >ref|XP_002312095.1| glycosyl transferase family 2 family protein [Populus trichocarpa] gb|PNT22927.1| hypothetical protein POPTR_008G055700v3 [Populus trichocarpa] Length = 335 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 +NEEHRLPGALDET+NYL+ERA KDKSF+YEV Sbjct: 75 FNEEHRLPGALDETINYLQERAAKDKSFTYEV 106 >ref|XP_010253172.1| PREDICTED: dolichyl-phosphate beta-glucosyltransferase-like isoform X1 [Nelumbo nucifera] Length = 339 Score = 62.4 bits (150), Expect = 1e-08 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 417 YNEEHRLPGALDETLNYLKERAGKDKSFSYEV 322 YNEEHRLPG LDET+NYL++RA KDKSFSYEV Sbjct: 75 YNEEHRLPGTLDETMNYLQQRAAKDKSFSYEV 106