BLASTX nr result
ID: Rehmannia30_contig00031725
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031725 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020551497.1| uncharacterized protein LOC105167625 [Sesamu... 57 4e-06 ref|XP_012840611.1| PREDICTED: uncharacterized protein LOC105960... 56 8e-06 gb|EYU34631.1| hypothetical protein MIMGU_mgv1a006941mg [Erythra... 56 8e-06 >ref|XP_020551497.1| uncharacterized protein LOC105167625 [Sesamum indicum] Length = 624 Score = 57.0 bits (136), Expect = 4e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 556 QFDCNGDLLHKISTKLASSSYGEGDLMSLIQS 461 QFDCNG+LLHKISTKL++SSYGE +L SLIQS Sbjct: 311 QFDCNGNLLHKISTKLSASSYGEAELTSLIQS 342 >ref|XP_012840611.1| PREDICTED: uncharacterized protein LOC105960942 [Erythranthe guttata] gb|EYU34632.1| hypothetical protein MIMGU_mgv1a006941mg [Erythranthe guttata] Length = 413 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 556 QFDCNGDLLHKISTKLASSSYGEGDLMSLIQS 461 QFDC+G+LLHKI+TKL++SSYGE +LMSLIQS Sbjct: 100 QFDCDGNLLHKINTKLSASSYGEDELMSLIQS 131 >gb|EYU34631.1| hypothetical protein MIMGU_mgv1a006941mg [Erythranthe guttata] Length = 425 Score = 55.8 bits (133), Expect = 8e-06 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 556 QFDCNGDLLHKISTKLASSSYGEGDLMSLIQS 461 QFDC+G+LLHKI+TKL++SSYGE +LMSLIQS Sbjct: 100 QFDCDGNLLHKINTKLSASSYGEDELMSLIQS 131