BLASTX nr result
ID: Rehmannia30_contig00031688
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031688 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09226.1| Leucine rich repeat protein [Handroanthus impetig... 67 1e-09 gb|PIN23995.1| Leucine rich repeat protein [Handroanthus impetig... 57 3e-06 >gb|PIN09226.1| Leucine rich repeat protein [Handroanthus impetiginosus] Length = 1020 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/47 (68%), Positives = 35/47 (74%) Frame = +2 Query: 389 MKIWCFPFLCFGEREEESVTSGNLYSFYCSNKGKEHIRNGDLGNVSE 529 MKIWCFPF CFGEREE+S S NLY YC +KGKE + G LGN SE Sbjct: 1 MKIWCFPFPCFGEREEDSRASSNLY--YCVDKGKERMWEGVLGNESE 45 >gb|PIN23995.1| Leucine rich repeat protein [Handroanthus impetiginosus] Length = 1027 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 2/49 (4%) Frame = +2 Query: 389 MKIWCFPFLCFGEREE--ESVTSGNLYSFYCSNKGKEHIRNGDLGNVSE 529 MKI CFPF+ FGERE+ TS + Y YC NKG+EH+R G LGN +E Sbjct: 1 MKICCFPFVFFGEREKVPNIETSRDTYYLYCFNKGEEHMREGCLGNENE 49