BLASTX nr result
ID: Rehmannia30_contig00031643
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031643 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100032.1| AT-hook motif nuclear-localized protein 29-l... 57 1e-06 gb|AMP82897.1| AT-hook motif nuclear-localized protein 29 [Catal... 55 7e-06 >ref|XP_011100032.1| AT-hook motif nuclear-localized protein 29-like [Sesamum indicum] Length = 307 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 3 GTTPPAAGPGNYQFSAELFGWGSGSSARPPF 95 G+TPP PGNY FSAELFGWGSGSSARPPF Sbjct: 280 GSTPP---PGNYPFSAELFGWGSGSSARPPF 307 >gb|AMP82897.1| AT-hook motif nuclear-localized protein 29 [Catalpa bungei] Length = 318 Score = 54.7 bits (130), Expect = 7e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 6 TTPPAAGPGNYQFSAELFGWGSGSSARPPF 95 +TPP PGNY FSAELFGWGSGSSARPPF Sbjct: 292 STPP---PGNYPFSAELFGWGSGSSARPPF 318