BLASTX nr result
ID: Rehmannia30_contig00030785
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030785 (662 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26273.1| hypothetical protein MIMGU_mgv1a004412mg [Erythra... 75 5e-12 ref|XP_012850744.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 75 5e-12 gb|EYU26263.1| hypothetical protein MIMGU_mgv1a019274mg [Erythra... 75 7e-12 ref|XP_012850606.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 71 4e-11 ref|XP_012850615.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 71 7e-11 gb|EYU26264.1| hypothetical protein MIMGU_mgv1a004586mg [Erythra... 71 1e-10 gb|EYU26261.1| hypothetical protein MIMGU_mgv1a004867mg [Erythra... 70 3e-10 ref|XP_012850655.1| PREDICTED: cytochrome P450 CYP72A219-like is... 70 3e-10 ref|XP_012850549.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 69 4e-10 gb|EYU26282.1| hypothetical protein MIMGU_mgv1a026663mg [Erythra... 69 5e-10 ref|XP_012850608.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 68 1e-09 gb|EYU26272.1| hypothetical protein MIMGU_mgv1a018891mg [Erythra... 68 2e-09 gb|EYU26266.1| hypothetical protein MIMGU_mgv1a0182362mg, partia... 67 2e-09 ref|XP_012850589.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 67 2e-09 gb|EYU26270.1| hypothetical protein MIMGU_mgv1a004948mg [Erythra... 67 4e-09 gb|EYU26262.1| hypothetical protein MIMGU_mgv1a022102mg [Erythra... 67 4e-09 ref|XP_012850654.1| PREDICTED: cytochrome P450 CYP72A219-like is... 67 4e-09 ref|XP_012850646.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 67 4e-09 ref|XP_012850588.1| PREDICTED: cytochrome P450 CYP72A219-like [E... 64 2e-08 gb|EYU26281.1| hypothetical protein MIMGU_mgv1a021321mg, partial... 64 2e-08 >gb|EYU26273.1| hypothetical protein MIMGU_mgv1a004412mg [Erythranthe guttata] Length = 528 Score = 75.1 bits (183), Expect = 5e-12 Identities = 32/48 (66%), Positives = 43/48 (89%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SCS MV+KLK+M++ +EGWCEID+WP+LEDLTG +IS Sbjct: 172 LKNMVPAIGVSCSKMVEKLKAMIN--DEGWCEIDMWPWLEDLTGDMIS 217 >ref|XP_012850744.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 529 Score = 75.1 bits (183), Expect = 5e-12 Identities = 32/48 (66%), Positives = 43/48 (89%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SCS MV+KLK+M++ +EGWCEID+WP+LEDLTG +IS Sbjct: 173 LKNMVPAIGVSCSKMVEKLKAMIN--DEGWCEIDMWPWLEDLTGDMIS 218 >gb|EYU26263.1| hypothetical protein MIMGU_mgv1a019274mg [Erythranthe guttata] Length = 525 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SCSNMV KLK +VSS NEG EID+WPY++DLTG +IS Sbjct: 164 LKNMVPAIGLSCSNMVQKLKEIVSSRNEGGFEIDMWPYIDDLTGDMIS 211 >ref|XP_012850606.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 269 Score = 71.2 bits (173), Expect = 4e-11 Identities = 31/48 (64%), Positives = 42/48 (87%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG SCS MV+KLK++++ +EGWCEID+WP+LEDLTG +IS Sbjct: 186 LKNMVPAIGQSCSKMVEKLKAIIN--DEGWCEIDMWPWLEDLTGDMIS 231 >ref|XP_012850615.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 359 Score = 71.2 bits (173), Expect = 7e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 527 MAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 M PAIG+SCSNMV KLK +VSS NEG EID+WPY++DLTG +IS Sbjct: 1 MVPAIGLSCSNMVQKLKEIVSSRNEGGFEIDMWPYIDDLTGDMIS 45 >gb|EYU26264.1| hypothetical protein MIMGU_mgv1a004586mg [Erythranthe guttata] Length = 519 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/48 (64%), Positives = 42/48 (87%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG SCS MV+KLK++++ +EGWCEID+WP+LEDLTG +IS Sbjct: 163 LKNMVPAIGQSCSKMVEKLKAIIN--DEGWCEIDMWPWLEDLTGDMIS 208 >gb|EYU26261.1| hypothetical protein MIMGU_mgv1a004867mg [Erythranthe guttata] Length = 506 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NMAPAIG+SC+NM+ KLKS V S+ +G CEID+W LED TG VIS Sbjct: 151 LKNMAPAIGLSCTNMISKLKSKVCSSTDGSCEIDMWACLEDFTGDVIS 198 >ref|XP_012850655.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Erythranthe guttata] Length = 529 Score = 69.7 bits (169), Expect = 3e-10 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NMAPAIG+SC+NM+ KLKS V S+ +G CEID+W LED TG VIS Sbjct: 164 LKNMAPAIGLSCTNMISKLKSKVCSSTDGSCEIDMWACLEDFTGDVIS 211 >ref|XP_012850549.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 384 Score = 69.3 bits (168), Expect = 4e-10 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNE--GWCEIDIWPYLEDLTGGVIS 661 ++NM P IG+SCSNM+ KS++S++N GW EID+WP+LEDLTG VIS Sbjct: 164 LKNMVPTIGLSCSNMIHNWKSIISNSNNEGGWSEIDVWPHLEDLTGDVIS 213 >gb|EYU26282.1| hypothetical protein MIMGU_mgv1a026663mg [Erythranthe guttata] Length = 528 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNE--GWCEIDIWPYLEDLTGGVIS 661 ++NM P IG+SCSNM+ KS++S++N GW EID+WP+LEDLTG VIS Sbjct: 163 LKNMVPTIGLSCSNMIHNWKSIISNSNNEGGWSEIDVWPHLEDLTGDVIS 212 >ref|XP_012850608.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] gb|EYU26274.1| hypothetical protein MIMGU_mgv1a004552mg [Erythranthe guttata] Length = 521 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/48 (60%), Positives = 40/48 (83%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++ M P IG+SCS+++ K K++VSS+NEGW EID+WP L+DLTG VIS Sbjct: 164 LKTMVPLIGLSCSSILQKWKAIVSSSNEGWNEIDVWPDLQDLTGDVIS 211 >gb|EYU26272.1| hypothetical protein MIMGU_mgv1a018891mg [Erythranthe guttata] Length = 526 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/49 (63%), Positives = 41/49 (83%), Gaps = 1/49 (2%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSS-TNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SCSNM++KLK + SS +EG EID+WPY++DLTG VIS Sbjct: 164 LKNMVPAIGLSCSNMINKLKEIASSRRDEGGFEIDMWPYIDDLTGDVIS 212 >gb|EYU26266.1| hypothetical protein MIMGU_mgv1a0182362mg, partial [Erythranthe guttata] Length = 380 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM P IG+SCS+++ K K++VSS+NEG EID+WP LEDLTG VIS Sbjct: 164 LKNMVPLIGLSCSSILQKWKAIVSSSNEGCSEIDVWPDLEDLTGDVIS 211 >ref|XP_012850589.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 462 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM P IG+SCS+++ K K++VSS+NEG EID+WP LEDLTG VIS Sbjct: 105 LKNMVPLIGLSCSSILQKWKAIVSSSNEGCSEIDVWPDLEDLTGDVIS 152 >gb|EYU26270.1| hypothetical protein MIMGU_mgv1a004948mg [Erythranthe guttata] Length = 503 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SC+NM+ KLKS V S+ G CEID+W LED TG VIS Sbjct: 144 LKNMVPAIGLSCTNMISKLKSKVCSSTGGSCEIDMWACLEDFTGDVIS 191 >gb|EYU26262.1| hypothetical protein MIMGU_mgv1a022102mg [Erythranthe guttata] Length = 516 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SC+NM+ KLKS V S+ G CEID+W LED TG VIS Sbjct: 151 LKNMVPAIGLSCTNMISKLKSKVCSSTGGSCEIDMWACLEDFTGDVIS 198 >ref|XP_012850654.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Erythranthe guttata] Length = 529 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SC+NM+ KLKS V S+ G CEID+W LED TG VIS Sbjct: 164 LKNMVPAIGLSCTNMISKLKSKVCSSTGGSCEIDMWACLEDFTGDVIS 211 >ref|XP_012850646.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 577 Score = 66.6 bits (161), Expect = 4e-09 Identities = 30/48 (62%), Positives = 37/48 (77%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNEGWCEIDIWPYLEDLTGGVIS 661 ++NM PAIG+SC+NM+ KLKS V S+ G CEID+W LED TG VIS Sbjct: 218 LKNMVPAIGLSCTNMISKLKSKVCSSTGGSCEIDMWACLEDFTGDVIS 265 >ref|XP_012850588.1| PREDICTED: cytochrome P450 CYP72A219-like [Erythranthe guttata] Length = 360 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/46 (65%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +2 Query: 527 MAPAIGISCSNMVDKLKSMVSST-NEGWCEIDIWPYLEDLTGGVIS 661 M PAIG+SCSNM++KLK + SS +EG EID+WPY++DLTG VIS Sbjct: 1 MVPAIGLSCSNMINKLKEIASSRRDEGGFEIDMWPYIDDLTGDVIS 46 >gb|EYU26281.1| hypothetical protein MIMGU_mgv1a021321mg, partial [Erythranthe guttata] Length = 360 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +2 Query: 518 IQNMAPAIGISCSNMVDKLKSMVSSTNE--GWCEIDIWPYLEDLTGGVIS 661 ++NM P IG+SCSNM+ K K++VSS +E EID+WP+LEDLTG VIS Sbjct: 164 LKNMVPLIGLSCSNMIQKWKAIVSSNSEKGSLSEIDVWPFLEDLTGDVIS 213