BLASTX nr result
ID: Rehmannia30_contig00030741
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030741 (517 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834777.1| PREDICTED: transcription elongation factor s... 66 2e-09 gb|EYU39646.1| hypothetical protein MIMGU_mgv1a000183mg [Erythra... 66 2e-09 gb|PIN24453.1| RNA polymerase II transcription elongation factor... 66 3e-09 ref|XP_011094503.1| protein RNA-directed DNA methylation 3 [Sesa... 65 7e-09 ref|XP_022854124.1| protein RNA-directed DNA methylation 3 [Olea... 55 1e-05 >ref|XP_012834777.1| PREDICTED: transcription elongation factor spt5 [Erythranthe guttata] Length = 1464 Score = 66.2 bits (160), Expect = 2e-09 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 6/80 (7%) Frame = -3 Query: 512 KVPHVPFLPKEKEMSKEELERMMAERHKSGAGFVTYMEDFCGNESDKIDAIMEHKLKKKN 333 K PH+PF+PKE+EMS+EELE+M+ ER+K GAGFVTY ED G E K ++ + + Sbjct: 83 KFPHLPFIPKEEEMSEEELEKMLEERYKPGAGFVTYSED--GYEHKK---SIDKNIFVPS 137 Query: 332 DREPR------QAGRSKRSS 291 D++P+ GR + S+ Sbjct: 138 DKDPQIWKVKCMVGRERHSA 157 >gb|EYU39646.1| hypothetical protein MIMGU_mgv1a000183mg [Erythranthe guttata] Length = 1476 Score = 66.2 bits (160), Expect = 2e-09 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 6/80 (7%) Frame = -3 Query: 512 KVPHVPFLPKEKEMSKEELERMMAERHKSGAGFVTYMEDFCGNESDKIDAIMEHKLKKKN 333 K PH+PF+PKE+EMS+EELE+M+ ER+K GAGFVTY ED G E K ++ + + Sbjct: 83 KFPHLPFIPKEEEMSEEELEKMLEERYKPGAGFVTYSED--GYEHKK---SIDKNIFVPS 137 Query: 332 DREPR------QAGRSKRSS 291 D++P+ GR + S+ Sbjct: 138 DKDPQIWKVKCMVGRERHSA 157 >gb|PIN24453.1| RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Handroanthus impetiginosus] Length = 1742 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = -3 Query: 512 KVPHVPFLPKEKEMSKEELERMMAERHKSGAGFVTYMEDFCGNES 378 KVP +PF+PKE+EMS+EELERM+ ER+K GAGFVTY +D+ +S Sbjct: 84 KVPQLPFVPKEEEMSEEELERMLEERYKPGAGFVTYADDYENKKS 128 >ref|XP_011094503.1| protein RNA-directed DNA methylation 3 [Sesamum indicum] ref|XP_011094504.1| protein RNA-directed DNA methylation 3 [Sesamum indicum] Length = 1720 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 512 KVPHVPFLPKEKEMSKEELERMMAERHKSGAGFVTYMED 396 KVP +PF+PKE+EMS+EELERM ER+K GAGFVTY ED Sbjct: 83 KVPDLPFIPKEEEMSEEELERMFEERYKPGAGFVTYAED 121 >ref|XP_022854124.1| protein RNA-directed DNA methylation 3 [Olea europaea var. sylvestris] ref|XP_022854125.1| protein RNA-directed DNA methylation 3 [Olea europaea var. sylvestris] ref|XP_022854126.1| protein RNA-directed DNA methylation 3 [Olea europaea var. sylvestris] Length = 1544 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -3 Query: 512 KVPHVPFLPKEKEMSKEELERMMAERHKSGAGFVTYMED 396 K P P PKE+EMS+EELERM+ ER+K+G+ FVTY ED Sbjct: 86 KPPQYPCFPKEEEMSEEELERMLEERYKTGSTFVTYAED 124