BLASTX nr result
ID: Rehmannia30_contig00030678
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030678 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08658.1| hypothetical protein CDL12_18767 [Handroanthus im... 40 1e-06 >gb|PIN08658.1| hypothetical protein CDL12_18767 [Handroanthus impetiginosus] Length = 360 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 21/31 (67%), Positives = 22/31 (70%) Frame = +2 Query: 161 VTWNDDVLT*ILLWLPTKFLTRIKLVCKHRL 253 V NDD+LT ILL LPTK L R K VCKH L Sbjct: 2 VAQNDDLLTEILLKLPTKSLIRFKSVCKHWL 32 Score = 39.7 bits (91), Expect(2) = 1e-06 Identities = 20/32 (62%), Positives = 21/32 (65%) Frame = +3 Query: 282 LLTLRHPKPGPSLILHTRTSQFFYFDQILYTE 377 L LRHPKP PSLIL TSQ FY IL T+ Sbjct: 43 LHALRHPKPQPSLILSAHTSQHFYLRPILGTK 74