BLASTX nr result
ID: Rehmannia30_contig00030597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030597 (502 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN10964.1| hypothetical protein CDL12_16454 [Handroanthus im... 58 3e-08 gb|OIT36289.1| hypothetical protein A4A49_20364 [Nicotiana atten... 55 2e-07 >gb|PIN10964.1| hypothetical protein CDL12_16454 [Handroanthus impetiginosus] Length = 72 Score = 57.8 bits (138), Expect = 3e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 323 KQFVVEDVNKKADEFIKYFRMQLKFERQQSLKRYSETIGKS 201 K FVV+DVN++ADEFIK FR QLK ERQ+SLKR ET KS Sbjct: 32 KNFVVKDVNEQADEFIKNFRKQLKIERQESLKRCHETRSKS 72 >gb|OIT36289.1| hypothetical protein A4A49_20364 [Nicotiana attenuata] Length = 69 Score = 55.5 bits (132), Expect = 2e-07 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = -3 Query: 344 RKAEENKKQFVVEDVNKKADEFIKYFRMQLKFERQQSLKRYSETIGK 204 R+ + ++F++EDVNK AD+FIK FR QLKFER++S KR+ E + + Sbjct: 21 RERIASTRRFLMEDVNKSADDFIKNFRKQLKFEREESFKRFQEMLNR 67