BLASTX nr result
ID: Rehmannia30_contig00030539
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030539 (668 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16692.1| hypothetical protein CDL12_10657 [Handroanthus im... 64 3e-08 gb|EYU18758.1| hypothetical protein MIMGU_mgv1a000625mg [Erythra... 63 7e-08 ref|XP_011075216.1| uncharacterized protein LOC105159735 isoform... 63 7e-08 ref|XP_012828072.1| PREDICTED: uncharacterized protein LOC105949... 63 7e-08 ref|XP_012828071.1| PREDICTED: uncharacterized protein LOC105949... 63 7e-08 ref|XP_011075215.1| uncharacterized protein LOC105159735 isoform... 63 7e-08 ref|XP_011075214.1| uncharacterized protein LOC105159735 isoform... 63 7e-08 >gb|PIN16692.1| hypothetical protein CDL12_10657 [Handroanthus impetiginosus] Length = 1099 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VSLEQSLWFLHKYIGE EKGE LDQVLVPI+QH Sbjct: 59 VSLEQSLWFLHKYIGESVEKGEHLDQVLVPIIQH 92 >gb|EYU18758.1| hypothetical protein MIMGU_mgv1a000625mg [Erythranthe guttata] Length = 1041 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VS+EQSLWFLHKYIGE +E GE LDQVLVPILQH Sbjct: 59 VSMEQSLWFLHKYIGEAAETGEHLDQVLVPILQH 92 >ref|XP_011075216.1| uncharacterized protein LOC105159735 isoform X3 [Sesamum indicum] Length = 1098 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VSLEQSLWFLHKYIGE +E+G+ LDQVLVPI+QH Sbjct: 59 VSLEQSLWFLHKYIGEAAERGDHLDQVLVPIIQH 92 >ref|XP_012828072.1| PREDICTED: uncharacterized protein LOC105949328 isoform X2 [Erythranthe guttata] Length = 1099 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VS+EQSLWFLHKYIGE +E GE LDQVLVPILQH Sbjct: 59 VSMEQSLWFLHKYIGEAAETGEHLDQVLVPILQH 92 >ref|XP_012828071.1| PREDICTED: uncharacterized protein LOC105949328 isoform X1 [Erythranthe guttata] Length = 1099 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VS+EQSLWFLHKYIGE +E GE LDQVLVPILQH Sbjct: 59 VSMEQSLWFLHKYIGEAAETGEHLDQVLVPILQH 92 >ref|XP_011075215.1| uncharacterized protein LOC105159735 isoform X2 [Sesamum indicum] Length = 1099 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VSLEQSLWFLHKYIGE +E+G+ LDQVLVPI+QH Sbjct: 59 VSLEQSLWFLHKYIGEAAERGDHLDQVLVPIIQH 92 >ref|XP_011075214.1| uncharacterized protein LOC105159735 isoform X1 [Sesamum indicum] Length = 1099 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +1 Query: 1 VSLEQSLWFLHKYIGEPSEKGEPLDQVLVPILQH 102 VSLEQSLWFLHKYIGE +E+G+ LDQVLVPI+QH Sbjct: 59 VSLEQSLWFLHKYIGEAAERGDHLDQVLVPIIQH 92