BLASTX nr result
ID: Rehmannia30_contig00030482
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030482 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852863.1| PREDICTED: cytochrome P450 CYP82D47-like [Er... 59 4e-07 gb|PIN12337.1| hypothetical protein CDL12_15056 [Handroanthus im... 57 2e-06 >ref|XP_012852863.1| PREDICTED: cytochrome P450 CYP82D47-like [Erythranthe guttata] Length = 531 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/49 (53%), Positives = 35/49 (71%) Frame = +2 Query: 287 MDSNIQLLLTILASLCTFSLFIYCYHQFLKPKNGTTNKTRLPRAGGALP 433 MDS +Q LLT+++S+C LF+ Y+ KP GT NK ++PRAGGALP Sbjct: 1 MDSFVQALLTVVSSICALILFVCSYNCLYKPNYGTKNKNQVPRAGGALP 49 >gb|PIN12337.1| hypothetical protein CDL12_15056 [Handroanthus impetiginosus] Length = 352 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 287 MDSNIQLLLTILASLCTFSLFIYCYHQFLKPKNGTTNKTRLPRAGGALP 433 MDS+IQLLLTIL+ + F LF+Y Y+Q KP NK ++PRAGGALP Sbjct: 1 MDSSIQLLLTILSCVFAFVLFVYFYNQLRKP-----NKNQIPRAGGALP 44