BLASTX nr result
ID: Rehmannia30_contig00030129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00030129 (508 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098740.1| UDP-glycosyltransferase 83A1 [Sesamum indicum] 61 1e-07 ref|XP_022866242.1| UDP-glycosyltransferase 83A1-like, partial [... 57 5e-07 ref|XP_012855216.1| PREDICTED: UDP-glycosyltransferase 83A1-like... 58 1e-06 gb|PIM98018.1| UDP-glucuronosyl and UDP-glucosyl transferase [Ha... 56 4e-06 ref|XP_022866177.1| UDP-glycosyltransferase 83A1-like [Olea euro... 56 6e-06 >ref|XP_011098740.1| UDP-glycosyltransferase 83A1 [Sesamum indicum] Length = 454 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 506 LCWPYFADQFLNQSYIVDHWEVGLG 432 LCWPYFADQFLNQ+YIVDHWEVGLG Sbjct: 367 LCWPYFADQFLNQTYIVDHWEVGLG 391 >ref|XP_022866242.1| UDP-glycosyltransferase 83A1-like, partial [Olea europaea var. sylvestris] Length = 181 Score = 57.4 bits (137), Expect = 5e-07 Identities = 25/36 (69%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Frame = -3 Query: 506 LCWPYFADQFLNQSYIVDHWEVG--LGRMIKGLTRK 405 LCWPYFADQF NQ+YI DHWEVG L R +G+ RK Sbjct: 53 LCWPYFADQFFNQTYICDHWEVGLELDRDARGIIRK 88 >ref|XP_012855216.1| PREDICTED: UDP-glycosyltransferase 83A1-like [Erythranthe guttata] gb|EYU44185.1| hypothetical protein MIMGU_mgv1a020666mg [Erythranthe guttata] Length = 460 Score = 57.8 bits (138), Expect = 1e-06 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = -3 Query: 506 LCWPYFADQFLNQSYIVDHWEVGLG 432 LCWPYFADQFLN+SYIVDHW VGLG Sbjct: 374 LCWPYFADQFLNRSYIVDHWGVGLG 398 >gb|PIM98018.1| UDP-glucuronosyl and UDP-glucosyl transferase [Handroanthus impetiginosus] Length = 455 Score = 56.2 bits (134), Expect = 4e-06 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = -3 Query: 506 LCWPYFADQFLNQSYIVDHWEVGLG 432 LCWP+F DQFLNQSY+VDHW++GLG Sbjct: 369 LCWPHFGDQFLNQSYVVDHWKIGLG 393 >ref|XP_022866177.1| UDP-glycosyltransferase 83A1-like [Olea europaea var. sylvestris] Length = 479 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/36 (66%), Positives = 28/36 (77%), Gaps = 2/36 (5%) Frame = -3 Query: 506 LCWPYFADQFLNQSYIVDHWEVG--LGRMIKGLTRK 405 LCWPYFADQF NQ+YI DHWEVG L + +G+ RK Sbjct: 389 LCWPYFADQFFNQTYICDHWEVGLELEKDARGIIRK 424