BLASTX nr result
ID: Rehmannia30_contig00028832
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028832 (427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN24710.1| Thioredoxin-like protein [Handroanthus impetigino... 63 4e-09 ref|XP_011081777.2| thioredoxin-related transmembrane protein 2 ... 63 4e-09 ref|XP_020549993.1| thioredoxin-related transmembrane protein 2 ... 57 1e-06 >gb|PIN24710.1| Thioredoxin-like protein [Handroanthus impetiginosus] Length = 259 Score = 63.2 bits (152), Expect = 4e-09 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +3 Query: 3 AKIFDSPVSKKLLCRHFELDKLLLDYINGK 92 AK FDSPVSKKLLCRHFELDKLLLDYINGK Sbjct: 230 AKFFDSPVSKKLLCRHFELDKLLLDYINGK 259 >ref|XP_011081777.2| thioredoxin-related transmembrane protein 2 homolog isoform X1 [Sesamum indicum] Length = 259 Score = 63.2 bits (152), Expect = 4e-09 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +3 Query: 3 AKIFDSPVSKKLLCRHFELDKLLLDYINGK 92 AK+FDSPVSKKLLCRHFELDK+LLDYINGK Sbjct: 230 AKLFDSPVSKKLLCRHFELDKILLDYINGK 259 >ref|XP_020549993.1| thioredoxin-related transmembrane protein 2 homolog isoform X2 [Sesamum indicum] Length = 258 Score = 56.6 bits (135), Expect = 1e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 3 AKIFDSPVSKKLLCRHFELDKLLLDYINGK 92 AK+FDSPVSK LLCRHFELDK+LLDYINGK Sbjct: 230 AKLFDSPVSK-LLCRHFELDKILLDYINGK 258