BLASTX nr result
ID: Rehmannia30_contig00028782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028782 (844 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097686.1| uncharacterized protein LOC105176546 [Sesamu... 60 3e-06 >ref|XP_011097686.1| uncharacterized protein LOC105176546 [Sesamum indicum] Length = 998 Score = 59.7 bits (143), Expect = 3e-06 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 15/100 (15%) Frame = -1 Query: 709 FCATVLQQINGNRSFLASRMLQVGARFAPSPIPI---------------YYSK*YKLIRL 575 FCA +LQQ NG+R+ LASRMLQVGA FAP+PIP K + ++L Sbjct: 702 FCAAILQQTNGSRNLLASRMLQVGAWFAPAPIPANLLAAAANNVPSTRNKLKKWTRCLKL 761 Query: 574 KVTCCLLLGFSSKSNTEEERRGFSSSLRVRVGFAQETNNK 455 + CC + +EEE S+ L VR+G A + N + Sbjct: 762 ALCCCSGCLANQTWKSEEE----SALLLVRLGLAWKVNRQ 797