BLASTX nr result
ID: Rehmannia30_contig00028758
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028758 (530 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN04407.1| hypothetical protein CDL12_23055 [Handroanthus im... 61 9e-08 gb|PIN06776.1| hypothetical protein CDL12_20660 [Handroanthus im... 60 2e-07 ref|XP_012853003.1| PREDICTED: uncharacterized protein At1g76660... 57 3e-06 ref|XP_011100676.1| uncharacterized protein At1g76660 [Sesamum i... 57 3e-06 >gb|PIN04407.1| hypothetical protein CDL12_23055 [Handroanthus impetiginosus] Length = 366 Score = 61.2 bits (147), Expect = 9e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 529 SRIGRKYQFGSSNSDAEIEYKRGLSLREWRNWRE 428 SR+GRKY FGSSNSDAEIEY+RG SLRE R+W+E Sbjct: 333 SRVGRKYHFGSSNSDAEIEYRRGRSLREQRSWKE 366 >gb|PIN06776.1| hypothetical protein CDL12_20660 [Handroanthus impetiginosus] Length = 462 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 529 SRIGRKYQFGSSNSDAEIEYKRGLSLREWRNWRES 425 SRI RKY FGSSNSDAEIEY+RG SLRE +WRES Sbjct: 428 SRISRKYHFGSSNSDAEIEYRRGRSLREGHSWRES 462 >ref|XP_012853003.1| PREDICTED: uncharacterized protein At1g76660-like [Erythranthe guttata] gb|EYU24333.1| hypothetical protein MIMGU_mgv1a007603mg [Erythranthe guttata] Length = 402 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 526 RIGRKYQFGSSNSDAEIEYKRGLSLREWRNWRES 425 R GRK+ FGSSNSDAE+EY+RG S+RE R+WRES Sbjct: 369 RNGRKFHFGSSNSDAEVEYRRGRSIREERSWRES 402 >ref|XP_011100676.1| uncharacterized protein At1g76660 [Sesamum indicum] ref|XP_011100686.1| uncharacterized protein At1g76660 [Sesamum indicum] ref|XP_011100695.1| uncharacterized protein At1g76660 [Sesamum indicum] ref|XP_020547707.1| uncharacterized protein At1g76660 [Sesamum indicum] Length = 479 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -2 Query: 526 RIGRKYQFGSSNSDAEIEYKRGLSLREWRNWRES 425 RIGRKY FGSSNSDAEIEY+RG SLRE R+ RES Sbjct: 446 RIGRKYHFGSSNSDAEIEYRRGRSLREERSRRES 479