BLASTX nr result
ID: Rehmannia30_contig00028558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00028558 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096101.1| homeobox-leucine zipper protein MERISTEM L1 ... 148 1e-38 gb|PIN03003.1| hypothetical protein CDL12_24476 [Handroanthus im... 145 1e-37 gb|KZV51409.1| hypothetical protein F511_20573 [Dorcoceras hygro... 144 3e-37 gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] 143 5e-37 ref|XP_011086174.2| LOW QUALITY PROTEIN: homeobox-leucine zipper... 140 5e-36 gb|KVI01078.1| Homeodomain-containing protein [Cynara cardunculu... 140 9e-36 ref|XP_012848972.1| PREDICTED: homeobox-leucine zipper protein M... 139 2e-35 ref|XP_021993721.1| homeobox-leucine zipper protein MERISTEM L1-... 136 2e-34 gb|KVH96954.1| Homeodomain-containing protein [Cynara cardunculu... 134 5e-34 ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein M... 135 6e-34 ref|XP_022863158.1| homeobox-leucine zipper protein MERISTEM L1-... 135 6e-34 ref|XP_023751202.1| homeobox-leucine zipper protein MERISTEM L1-... 134 8e-34 ref|XP_023771293.1| homeobox-leucine zipper protein MERISTEM L1-... 134 1e-33 ref|XP_009597904.1| PREDICTED: homeobox-leucine zipper protein M... 132 5e-33 ref|XP_016486479.1| PREDICTED: homeobox-leucine zipper protein M... 131 1e-32 ref|XP_019170324.1| PREDICTED: homeobox-leucine zipper protein M... 130 3e-32 ref|XP_019249652.1| PREDICTED: homeobox-leucine zipper protein M... 130 3e-32 ref|XP_009799795.1| PREDICTED: homeobox-leucine zipper protein M... 130 3e-32 ref|XP_016545426.1| PREDICTED: homeobox-leucine zipper protein M... 130 3e-32 ref|XP_022877991.1| homeobox-leucine zipper protein MERISTEM L1-... 129 5e-32 >ref|XP_011096101.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_011096102.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_011096103.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_020554106.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] ref|XP_020554107.1| homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] Length = 726 Score = 148 bits (373), Expect = 1e-38 Identities = 66/70 (94%), Positives = 69/70 (98%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPN+FESHHHLLDM HKTPENEMDLIRDDEYESKSGT+IMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNLFESHHHLLDMGHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 404 YHRHTQHQIQ 433 YHRHTQHQIQ Sbjct: 61 YHRHTQHQIQ 70 >gb|PIN03003.1| hypothetical protein CDL12_24476 [Handroanthus impetiginosus] Length = 726 Score = 145 bits (366), Expect = 1e-37 Identities = 65/70 (92%), Positives = 69/70 (98%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPNMF+SHH LLDM+HKTPENEMDLIRDDEYESKSGT+IMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHQLLDMAHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 404 YHRHTQHQIQ 433 YHRHTQHQIQ Sbjct: 61 YHRHTQHQIQ 70 >gb|KZV51409.1| hypothetical protein F511_20573 [Dorcoceras hygrometricum] Length = 726 Score = 144 bits (363), Expect = 3e-37 Identities = 63/70 (90%), Positives = 69/70 (98%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPNMF+SHHHLLD+ HK+PENE+DLIRDDEYESKSGT+IMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHHLLDLGHKSPENELDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 404 YHRHTQHQIQ 433 YHRHTQHQIQ Sbjct: 61 YHRHTQHQIQ 70 >gb|EPS62656.1| hypothetical protein M569_12132 [Genlisea aurea] Length = 712 Score = 143 bits (361), Expect = 5e-37 Identities = 62/70 (88%), Positives = 69/70 (98%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPNMF+SHHHLL+M HKTPEN++D+IRDDEYESKSGT+IMEAPSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHHLLEMGHKTPENDLDIIRDDEYESKSGTDIMEAPSGDDQDPNQRPKKKR 60 Query: 404 YHRHTQHQIQ 433 YHRHTQHQIQ Sbjct: 61 YHRHTQHQIQ 70 >ref|XP_011086174.2| LOW QUALITY PROTEIN: homeobox-leucine zipper protein MERISTEM L1 [Sesamum indicum] Length = 733 Score = 140 bits (354), Expect = 5e-36 Identities = 65/71 (91%), Positives = 70/71 (98%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPN+FESHHHLLDM+HKTPENEMDLIRDDEYESKSGT+IMEAPSGD+QDPNQRP KKK Sbjct: 1 MFQPNIFESHHHLLDMAHKTPENEMDLIRDDEYESKSGTDIMEAPSGDDQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RY+RHTQHQIQ Sbjct: 61 RYNRHTQHQIQ 71 >gb|KVI01078.1| Homeodomain-containing protein [Cynara cardunculus var. scolymus] Length = 694 Score = 140 bits (352), Expect = 9e-36 Identities = 66/72 (91%), Positives = 70/72 (97%), Gaps = 2/72 (2%) Frame = +2 Query: 224 MFQPNMFESHHH-LLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KK 397 MFQPNMFESHHH LLDMSHKTPENE+D++RDDEYESKSGT+IMEAPSGDEQDPNQRP KK Sbjct: 1 MFQPNMFESHHHHLLDMSHKTPENELDMLRDDEYESKSGTDIMEAPSGDEQDPNQRPNKK 60 Query: 398 KRYHRHTQHQIQ 433 KRYHRHTQHQIQ Sbjct: 61 KRYHRHTQHQIQ 72 >ref|XP_012848972.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Erythranthe guttata] ref|XP_012848973.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Erythranthe guttata] gb|EYU27818.1| hypothetical protein MIMGU_mgv1a002017mg [Erythranthe guttata] Length = 726 Score = 139 bits (349), Expect = 2e-35 Identities = 66/72 (91%), Positives = 69/72 (95%), Gaps = 2/72 (2%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSH-KTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KK 397 MFQPNMF+SHHHLLDM H KTPENEMDLIRDD+YESKSGT+IMEAPSGDEQDPNQRP KK Sbjct: 1 MFQPNMFDSHHHLLDMGHNKTPENEMDLIRDDDYESKSGTDIMEAPSGDEQDPNQRPNKK 60 Query: 398 KRYHRHTQHQIQ 433 KRYHRHTQHQIQ Sbjct: 61 KRYHRHTQHQIQ 72 >ref|XP_021993721.1| homeobox-leucine zipper protein MERISTEM L1-like [Helianthus annuus] ref|XP_021993722.1| homeobox-leucine zipper protein MERISTEM L1-like [Helianthus annuus] gb|OTG08199.1| putative START domain, Homeodomain-like, START-like domain protein [Helianthus annuus] Length = 728 Score = 136 bits (343), Expect = 2e-34 Identities = 62/71 (87%), Positives = 68/71 (95%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHHLLDMSHKT ENE+D++RDD+YESKSGT+IMEAPSGD+ DPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKTTENELDMLRDDDYESKSGTDIMEAPSGDDLDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQHQIQ Sbjct: 61 RYHRHTQHQIQ 71 >gb|KVH96954.1| Homeodomain-containing protein [Cynara cardunculus var. scolymus] Length = 622 Score = 134 bits (338), Expect = 5e-34 Identities = 60/71 (84%), Positives = 69/71 (97%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHH+LDMSHKTPE+E+D++RD++YESKSGT+IMEA SGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHILDMSHKTPEHELDMLRDEDYESKSGTDIMEAHSGDDQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQHQIQ Sbjct: 61 RYHRHTQHQIQ 71 >ref|XP_002266688.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Vitis vinifera] emb|CBI23181.3| unnamed protein product, partial [Vitis vinifera] Length = 726 Score = 135 bits (339), Expect = 6e-34 Identities = 60/70 (85%), Positives = 66/70 (94%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPNMF+SHHHLLDM HKTPE+EM IRD+E+ESKSGTE M+APSGD+QDPNQRPKKKR Sbjct: 1 MFQPNMFDSHHHLLDMPHKTPESEMGKIRDEEFESKSGTENMDAPSGDDQDPNQRPKKKR 60 Query: 404 YHRHTQHQIQ 433 YHRHTQHQIQ Sbjct: 61 YHRHTQHQIQ 70 >ref|XP_022863158.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] ref|XP_022863159.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] Length = 727 Score = 135 bits (339), Expect = 6e-34 Identities = 61/69 (88%), Positives = 66/69 (95%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPNMF+SHH LLDMSHK+PENEMDLIRDDE+ESKS T+IMEAPSGD+ DPNQRPKKKR Sbjct: 2 MFQPNMFDSHHSLLDMSHKSPENEMDLIRDDEFESKSVTDIMEAPSGDDGDPNQRPKKKR 61 Query: 404 YHRHTQHQI 430 YHRHTQHQI Sbjct: 62 YHRHTQHQI 70 >ref|XP_023751202.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751204.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751205.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751206.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] ref|XP_023751207.1| homeobox-leucine zipper protein MERISTEM L1-like isoform X1 [Lactuca sativa] gb|PLY95002.1| hypothetical protein LSAT_1X121861 [Lactuca sativa] Length = 730 Score = 134 bits (338), Expect = 8e-34 Identities = 62/73 (84%), Positives = 70/73 (95%), Gaps = 3/73 (4%) Frame = +2 Query: 224 MFQPNMFESHHH--LLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-K 394 MFQPNMFESHHH LLDMSHK+PEN++D++RDD+YESKSGT+IMEAPSGD+QDPNQRP K Sbjct: 1 MFQPNMFESHHHHHLLDMSHKSPENQLDMLRDDDYESKSGTDIMEAPSGDDQDPNQRPNK 60 Query: 395 KKRYHRHTQHQIQ 433 KKRYHRHTQHQIQ Sbjct: 61 KKRYHRHTQHQIQ 73 >ref|XP_023771293.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771295.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771301.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771310.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] ref|XP_023771319.1| homeobox-leucine zipper protein MERISTEM L1-like [Lactuca sativa] gb|PLY97912.1| hypothetical protein LSAT_4X60501 [Lactuca sativa] Length = 725 Score = 134 bits (337), Expect = 1e-33 Identities = 61/71 (85%), Positives = 67/71 (94%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHH+LDMSHK ENE+D++RDD+YESKSGT+IMEA SGDEQDPNQRP KKK Sbjct: 1 MFQPNMFESHHHILDMSHKAQENELDMLRDDDYESKSGTDIMEAHSGDEQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQHQIQ Sbjct: 61 RYHRHTQHQIQ 71 >ref|XP_009597904.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tomentosiformis] ref|XP_018625490.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tomentosiformis] ref|XP_018625491.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tomentosiformis] Length = 730 Score = 132 bits (332), Expect = 5e-33 Identities = 60/71 (84%), Positives = 68/71 (95%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHHLLDMSHK+PENE+D+IRDDE+++KSGT+IME PSGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENELDIIRDDEFDTKSGTDIMENPSGDDQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQ QIQ Sbjct: 61 RYHRHTQLQIQ 71 >ref|XP_016486479.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] ref|XP_016486480.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] Length = 730 Score = 131 bits (330), Expect = 1e-32 Identities = 60/71 (84%), Positives = 67/71 (94%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHHLLDMSHK+PENE+D IRDDE+++KSGT+IME PSGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENELDFIRDDEFDTKSGTDIMENPSGDDQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQ QIQ Sbjct: 61 RYHRHTQLQIQ 71 >ref|XP_019170324.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019170325.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019170326.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019170327.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] ref|XP_019170328.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Ipomoea nil] Length = 729 Score = 130 bits (327), Expect = 3e-32 Identities = 63/73 (86%), Positives = 69/73 (94%), Gaps = 3/73 (4%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMS-HKTPENEMD-LIRDDEYESKSGTEIMEAPSGDEQDPNQRP-K 394 MFQPNM+ESHHHLLDMS HK PENE+D +IRD+EYESKSGT+IMEAPSGD+QDPNQRP K Sbjct: 1 MFQPNMYESHHHLLDMSSHKNPENELDNIIRDEEYESKSGTDIMEAPSGDDQDPNQRPNK 60 Query: 395 KKRYHRHTQHQIQ 433 KKRYHRHTQHQIQ Sbjct: 61 KKRYHRHTQHQIQ 73 >ref|XP_019249652.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana attenuata] gb|OIT00329.1| homeobox-leucine zipper protein meristem l1 [Nicotiana attenuata] Length = 730 Score = 130 bits (327), Expect = 3e-32 Identities = 60/71 (84%), Positives = 67/71 (94%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHHLLDMSHK+PENE+DLI DDE+++KSGT+IME PSGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENELDLIPDDEFDTKSGTDIMENPSGDDQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQ QIQ Sbjct: 61 RYHRHTQLQIQ 71 >ref|XP_009799795.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana sylvestris] ref|XP_009799796.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana sylvestris] ref|XP_009799798.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana sylvestris] ref|XP_009799799.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana sylvestris] ref|XP_009799800.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana sylvestris] ref|XP_016466997.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] ref|XP_016466998.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] ref|XP_016466999.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] ref|XP_016467000.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] ref|XP_016467001.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1-like [Nicotiana tabacum] Length = 730 Score = 130 bits (327), Expect = 3e-32 Identities = 60/71 (84%), Positives = 67/71 (94%), Gaps = 1/71 (1%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRP-KKK 400 MFQPNMFESHHHLLDMSHK+PENE+DLI DDE+++KSGT+IME PSGD+QDPNQRP KKK Sbjct: 1 MFQPNMFESHHHLLDMSHKSPENELDLIPDDEFDTKSGTDIMENPSGDDQDPNQRPNKKK 60 Query: 401 RYHRHTQHQIQ 433 RYHRHTQ QIQ Sbjct: 61 RYHRHTQIQIQ 71 >ref|XP_016545426.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Capsicum annuum] ref|XP_016545427.1| PREDICTED: homeobox-leucine zipper protein MERISTEM L1 [Capsicum annuum] gb|PHT69952.1| Homeobox-leucine zipper protein MERISTEM L1 [Capsicum annuum] Length = 731 Score = 130 bits (326), Expect = 3e-32 Identities = 58/70 (82%), Positives = 67/70 (95%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQ NMF+SH+ LLDM+ KTPENE+DLIRDDE+ESKSGT+IMEAPSGD+QDPN+RPKKK+ Sbjct: 1 MFQHNMFDSHNFLLDMTRKTPENELDLIRDDEFESKSGTDIMEAPSGDDQDPNKRPKKKQ 60 Query: 404 YHRHTQHQIQ 433 YHRHTQHQIQ Sbjct: 61 YHRHTQHQIQ 70 >ref|XP_022877991.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] ref|XP_022877992.1| homeobox-leucine zipper protein MERISTEM L1-like [Olea europaea var. sylvestris] Length = 726 Score = 129 bits (325), Expect = 5e-32 Identities = 58/69 (84%), Positives = 64/69 (92%) Frame = +2 Query: 224 MFQPNMFESHHHLLDMSHKTPENEMDLIRDDEYESKSGTEIMEAPSGDEQDPNQRPKKKR 403 MFQPNMF+SHH LLDM HKTPENEMDLI+DDE++SKS T+IMEAPSGD+ DPN RPKKKR Sbjct: 2 MFQPNMFDSHHSLLDMIHKTPENEMDLIKDDEFDSKSVTDIMEAPSGDDGDPNPRPKKKR 61 Query: 404 YHRHTQHQI 430 YHRHTQHQI Sbjct: 62 YHRHTQHQI 70