BLASTX nr result
ID: Rehmannia30_contig00026816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026816 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIT19063.1| hypothetical protein A4A49_42526 [Nicotiana atten... 80 3e-16 ref|XP_018628934.1| PREDICTED: uncharacterized protein LOC108946... 50 2e-12 ref|XP_016435338.1| PREDICTED: NADH dehydrogenase [ubiquinone] i... 50 1e-11 ref|XP_022897753.1| QWRF motif-containing protein 2-like [Olea e... 72 1e-11 gb|KYP77511.1| NADH-ubiquinone oxidoreductase 49 kDa subunit [Ca... 69 1e-10 ref|XP_022897754.1| uncharacterized protein LOC111411454 [Olea e... 50 1e-10 gb|PHT65743.1| hypothetical protein T459_30168 [Capsicum annuum] 50 1e-10 gb|PHT63279.1| hypothetical protein T459_32856 [Capsicum annuum] 45 1e-08 gb|PHT91669.1| hypothetical protein T459_06782 [Capsicum annuum] 45 3e-08 dbj|GAU19211.1| hypothetical protein TSUD_198940, partial [Trifo... 60 6e-08 gb|KOM37976.1| hypothetical protein LR48_Vigan03g135800 [Vigna a... 61 6e-08 emb|CDY45549.1| BnaCnng13080D [Brassica napus] 57 6e-08 gb|EXC33547.1| NADH dehydrogenase [ubiquinone] iron-sulfur prote... 58 8e-07 gb|PHT76137.1| hypothetical protein T459_19659 [Capsicum annuum] 44 7e-06 >gb|OIT19063.1| hypothetical protein A4A49_42526 [Nicotiana attenuata] Length = 150 Score = 80.5 bits (197), Expect = 3e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = -2 Query: 192 PVLSKDCPLSDGCWSSLLRGSRIQQPNLYKGHQSPFTRLEL 70 PV+SKDCPLS G WSSLLRGSRIQQPNLYKGHQSP TRLEL Sbjct: 110 PVVSKDCPLSAGSWSSLLRGSRIQQPNLYKGHQSPLTRLEL 150 >ref|XP_018628934.1| PREDICTED: uncharacterized protein LOC108946483 [Nicotiana tomentosiformis] Length = 202 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +3 Query: 321 IESLMMGNYHVRFGERWDRLYN 386 IES MMGNYHVRFGERWDRLYN Sbjct: 71 IESPMMGNYHVRFGERWDRLYN 92 Score = 49.7 bits (117), Expect(2) = 2e-12 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YNRGSRCKLFLSIAGQMTTGSSV Sbjct: 91 YNRGSRCKLFLSIAGQMTTGSSV 113 >ref|XP_016435338.1| PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 2-like [Nicotiana tabacum] Length = 201 Score = 49.7 bits (117), Expect(2) = 1e-11 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YNRGSRCKLFLSIAGQMTTGSSV Sbjct: 90 YNRGSRCKLFLSIAGQMTTGSSV 112 Score = 47.4 bits (111), Expect(2) = 1e-11 Identities = 20/22 (90%), Positives = 20/22 (90%) Frame = +3 Query: 321 IESLMMGNYHVRFGERWDRLYN 386 IES MGNYHVRFGERWDRLYN Sbjct: 70 IESPTMGNYHVRFGERWDRLYN 91 >ref|XP_022897753.1| QWRF motif-containing protein 2-like [Olea europaea var. sylvestris] Length = 758 Score = 71.6 bits (174), Expect = 1e-11 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 110 RLGCWIRDPRSRLDQHPSERGQSLERTGCTYPR 208 +LGCWIRDPRSRLDQHP ERGQSLE TGCTYPR Sbjct: 643 KLGCWIRDPRSRLDQHPPERGQSLETTGCTYPR 675 >gb|KYP77511.1| NADH-ubiquinone oxidoreductase 49 kDa subunit [Cajanus cajan] Length = 446 Score = 68.9 bits (167), Expect = 1e-10 Identities = 41/97 (42%), Positives = 51/97 (52%), Gaps = 4/97 (4%) Frame = +2 Query: 65 LHSSNLVKGL*CPLYRLGCWIRDPRSRLDQHPSERGQSLERTGCTYPR*AKR*RVGVNQR 244 + SSNL K P +RLGCWIRDPRSRLDQHP+ERGQ LE T R Sbjct: 224 MESSNLDKAFFFPFFRLGCWIRDPRSRLDQHPAERGQPLEATSWE------------TNR 271 Query: 245 TLRLFYR----RSQLSSERISSLVMAQSIDRKPYDGK 343 TLR+F RS S + +++ ++ DGK Sbjct: 272 TLRVFLSSSRPRSSTDKPLTPSSLGLRALGKRSSDGK 308 >ref|XP_022897754.1| uncharacterized protein LOC111411454 [Olea europaea var. sylvestris] Length = 127 Score = 49.7 bits (117), Expect(2) = 1e-10 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YNRGSRCKLFLSIAGQMTTGSSV Sbjct: 16 YNRGSRCKLFLSIAGQMTTGSSV 38 Score = 43.9 bits (102), Expect(2) = 1e-10 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 336 MGNYHVRFGERWDRLYN 386 MGNYHVRFGERWDRLYN Sbjct: 1 MGNYHVRFGERWDRLYN 17 >gb|PHT65743.1| hypothetical protein T459_30168 [Capsicum annuum] Length = 127 Score = 49.7 bits (117), Expect(2) = 1e-10 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YNRGSRCKLFLSIAGQMTTGSSV Sbjct: 16 YNRGSRCKLFLSIAGQMTTGSSV 38 Score = 43.9 bits (102), Expect(2) = 1e-10 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 336 MGNYHVRFGERWDRLYN 386 MGNYHVRFGERWDRLYN Sbjct: 1 MGNYHVRFGERWDRLYN 17 >gb|PHT63279.1| hypothetical protein T459_32856 [Capsicum annuum] Length = 96 Score = 45.1 bits (105), Expect(2) = 1e-08 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YN+GSRCKLFLSIAGQMTT SSV Sbjct: 16 YNKGSRCKLFLSIAGQMTTVSSV 38 Score = 41.6 bits (96), Expect(2) = 1e-08 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 336 MGNYHVRFGERWDRLYN 386 MGNYHV FGERWDRLYN Sbjct: 1 MGNYHVSFGERWDRLYN 17 >gb|PHT91669.1| hypothetical protein T459_06782 [Capsicum annuum] Length = 84 Score = 45.4 bits (106), Expect(2) = 3e-08 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YNRG+RCKLF+SIAGQM TGSSV Sbjct: 16 YNRGNRCKLFVSIAGQMNTGSSV 38 Score = 40.4 bits (93), Expect(2) = 3e-08 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +3 Query: 336 MGNYHVRFGERWDRLYN 386 MGNYHVRFGERW++LYN Sbjct: 1 MGNYHVRFGERWNQLYN 17 >dbj|GAU19211.1| hypothetical protein TSUD_198940, partial [Trifolium subterraneum] Length = 202 Score = 59.7 bits (143), Expect = 6e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -2 Query: 183 SKDCPLSDGCWSSLLRGSRIQQPNLYKGHQSPFTRLE 73 SK CPLS GCWSSLLRGSRIQQPNL KG + +RL+ Sbjct: 102 SKGCPLSAGCWSSLLRGSRIQQPNLKKGKKKALSRLD 138 >gb|KOM37976.1| hypothetical protein LR48_Vigan03g135800 [Vigna angularis] Length = 351 Score = 60.8 bits (146), Expect = 6e-08 Identities = 40/91 (43%), Positives = 44/91 (48%) Frame = +2 Query: 2 RSCAPAEKALSLFNQK*NVGKLHSSNLVKGL*CPLYRLGCWIRDPRSRLDQHPSERGQSL 181 R APAEKALSL + K LGCWIRDPRSRLDQHP+ERGQ L Sbjct: 242 RVSAPAEKALSLDSNK---------------------LGCWIRDPRSRLDQHPAERGQPL 280 Query: 182 ERTGCTYPR*AKR*RVGVNQRTLRLFYRRSQ 274 E T RTLR+F S+ Sbjct: 281 EATSWE------------TNRTLRVFLSSSR 299 >emb|CDY45549.1| BnaCnng13080D [Brassica napus] Length = 69 Score = 56.6 bits (135), Expect = 6e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 248 LRLFYRRSQLSSERISSLVMAQSIDRKPYDGKLPR 352 ++L SQLSSERI SLVMAQSIDRKPYDGKLPR Sbjct: 35 MKLSMESSQLSSERIRSLVMAQSIDRKPYDGKLPR 69 >gb|EXC33547.1| NADH dehydrogenase [ubiquinone] iron-sulfur protein 2 [Morus notabilis] Length = 402 Score = 57.8 bits (138), Expect = 8e-07 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +2 Query: 101 PLYRLGCWIRDPRSRLDQHPSERGQSLERTG 193 P+ LGCWIRDPRSRLDQHP+ERGQ LE G Sbjct: 271 PILELGCWIRDPRSRLDQHPAERGQPLEAIG 301 >gb|PHT76137.1| hypothetical protein T459_19659 [Capsicum annuum] Length = 126 Score = 43.9 bits (102), Expect(2) = 7e-06 Identities = 17/17 (100%), Positives = 17/17 (100%) Frame = +3 Query: 336 MGNYHVRFGERWDRLYN 386 MGNYHVRFGERWDRLYN Sbjct: 1 MGNYHVRFGERWDRLYN 17 Score = 33.5 bits (75), Expect(2) = 7e-06 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = +2 Query: 386 YNRGSRCKLFLSIAGQMTTGSSV 454 YN+GSRCKLF SIA QMT GS + Sbjct: 16 YNKGSRCKLF-SIAIQMTIGSLI 37