BLASTX nr result
ID: Rehmannia30_contig00026754
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00026754 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26139.1| Nucleotide-sugar transporter VRG4/SQV-7 [Handroan... 113 5e-27 gb|KZV22172.1| hypothetical protein F511_27342, partial [Dorcoce... 95 2e-20 ref|XP_011090177.1| GDP-mannose transporter GONST1 isoform X1 [S... 91 9e-19 ref|XP_022898345.1| GDP-mannose transporter GONST1-like isoform ... 84 3e-16 ref|XP_022897972.1| GDP-mannose transporter GONST1-like isoform ... 83 4e-16 ref|XP_012838445.1| PREDICTED: GDP-mannose transporter GONST1-li... 83 5e-16 ref|XP_022897970.1| GDP-mannose transporter GONST1-like isoform ... 83 5e-16 ref|XP_020550138.1| GDP-mannose transporter GONST1-like isoform ... 81 1e-15 ref|XP_011080450.1| GDP-mannose transporter GONST1-like isoform ... 81 3e-15 gb|PHU03127.1| GDP-mannose transporter GONST1, partial [Capsicum... 79 2e-14 ref|XP_021636726.1| GDP-mannose transporter GONST1-like isoform ... 79 2e-14 gb|PHT68540.1| GDP-mannose transporter GONST1, partial [Capsicum... 79 3e-14 ref|XP_016542725.1| PREDICTED: GDP-mannose transporter GONST1-li... 79 3e-14 ref|XP_016542724.1| PREDICTED: GDP-mannose transporter GONST1-li... 79 3e-14 ref|XP_016441323.1| PREDICTED: GDP-mannose transporter GONST1-li... 78 3e-14 ref|XP_009760359.1| PREDICTED: GDP-mannose transporter GONST1 is... 78 3e-14 ref|XP_016441322.1| PREDICTED: GDP-mannose transporter GONST1-li... 78 3e-14 ref|XP_009760358.1| PREDICTED: GDP-mannose transporter GONST1 is... 78 3e-14 ref|XP_009590643.1| PREDICTED: GDP-mannose transporter GONST1 is... 77 7e-14 ref|XP_015059041.1| PREDICTED: GDP-mannose transporter GONST1-li... 77 9e-14 >gb|PIN26139.1| Nucleotide-sugar transporter VRG4/SQV-7 [Handroanthus impetiginosus] Length = 398 Score = 113 bits (282), Expect = 5e-27 Identities = 55/76 (72%), Positives = 66/76 (86%) Frame = -1 Query: 229 ENHQL*GLLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVR 50 +NHQL GL DQV VRREIASRSF MKTP+NND+ID+E+G+ GKD EKA++S+R+LT+ Sbjct: 39 KNHQLYGLPDQVSSPVRREIASRSFGMKTPSNNDEIDMESGRFGKDREKAVQSKRVLTIH 98 Query: 49 NPALLSGLAYCFSSCS 2 N ALLSGLAYCFSSCS Sbjct: 99 NKALLSGLAYCFSSCS 114 >gb|KZV22172.1| hypothetical protein F511_27342, partial [Dorcoceras hygrometricum] Length = 392 Score = 95.1 bits (235), Expect = 2e-20 Identities = 49/76 (64%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = -1 Query: 226 NHQL*GLLDQVPGLVRREIASR-SFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVR 50 NHQL LLDQV VRR++ SR SF M+TP NND+IDVE+G+ KD EKA+RS++ + + Sbjct: 33 NHQLNSLLDQVSSPVRRDLVSRASFGMRTPGNNDEIDVESGRIEKDREKAVRSKKGIALY 92 Query: 49 NPALLSGLAYCFSSCS 2 N ALLSGLAYCFSSCS Sbjct: 93 NQALLSGLAYCFSSCS 108 >ref|XP_011090177.1| GDP-mannose transporter GONST1 isoform X1 [Sesamum indicum] Length = 399 Score = 90.9 bits (224), Expect = 9e-19 Identities = 48/76 (63%), Positives = 56/76 (73%), Gaps = 1/76 (1%) Frame = -1 Query: 229 ENHQL*GLLDQVPGLVRREIASRS-FRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTV 53 +NHQ +DQV VRREIASRS MKTPNNND DVE+G+ K+ EKA RS+R L++ Sbjct: 39 KNHQFNAFVDQVSSPVRREIASRSSLGMKTPNNNDQTDVESGRLEKEREKATRSKRGLSL 98 Query: 52 RNPALLSGLAYCFSSC 5 N A LSGLAYCFSSC Sbjct: 99 HNKAFLSGLAYCFSSC 114 >ref|XP_022898345.1| GDP-mannose transporter GONST1-like isoform X1 [Olea europaea var. sylvestris] Length = 381 Score = 84.0 bits (206), Expect = 3e-16 Identities = 46/78 (58%), Positives = 57/78 (73%), Gaps = 2/78 (2%) Frame = -1 Query: 229 ENHQL*GLLDQVPGLVRREIASRS-FRMKTPNNNDDIDVETGKSGKDIEKAMRS-RRILT 56 ++HQL GL DQV VRRE+ SRS M TPNN D+IDVE+GK + EK + S +R+L Sbjct: 17 KSHQLNGLPDQVSSPVRREVVSRSALVMSTPNNYDEIDVESGKCEEGREKPVHSSKRVLR 76 Query: 55 VRNPALLSGLAYCFSSCS 2 + N ALL+GLAYCFSSCS Sbjct: 77 IHNQALLAGLAYCFSSCS 94 >ref|XP_022897972.1| GDP-mannose transporter GONST1-like isoform X2 [Olea europaea var. sylvestris] Length = 350 Score = 83.2 bits (204), Expect = 4e-16 Identities = 45/78 (57%), Positives = 58/78 (74%), Gaps = 2/78 (2%) Frame = -1 Query: 229 ENHQL*GLLDQVPGLVRREIASRS-FRMKTPNNNDDIDVETGKSGKDIEKAMRS-RRILT 56 ++HQL GL D+V VRRE+ SRS M TP+N D+IDVE+GK + EK +RS +R+L Sbjct: 17 KSHQLNGLPDEVSSPVRREVVSRSALGMNTPSNYDEIDVESGKLEEGREKTVRSSKRVLR 76 Query: 55 VRNPALLSGLAYCFSSCS 2 + N ALL+GLAYCFSSCS Sbjct: 77 IHNQALLAGLAYCFSSCS 94 >ref|XP_012838445.1| PREDICTED: GDP-mannose transporter GONST1-like [Erythranthe guttata] Length = 373 Score = 83.2 bits (204), Expect = 5e-16 Identities = 44/76 (57%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = -1 Query: 226 NHQL*GLLDQVPGLVRREIASRSFR-MKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVR 50 NHQ +DQV RREIA+RS MK P+++++IDVE+G+ KD EK++RS+R LT+ Sbjct: 12 NHQFTTSVDQVSSPARREIANRSLSGMKFPSDSEEIDVESGRLDKDREKSVRSKRGLTLH 71 Query: 49 NPALLSGLAYCFSSCS 2 N ALLSGLAYC SSCS Sbjct: 72 NQALLSGLAYCLSSCS 87 >ref|XP_022897970.1| GDP-mannose transporter GONST1-like isoform X1 [Olea europaea var. sylvestris] Length = 383 Score = 83.2 bits (204), Expect = 5e-16 Identities = 45/78 (57%), Positives = 58/78 (74%), Gaps = 2/78 (2%) Frame = -1 Query: 229 ENHQL*GLLDQVPGLVRREIASRS-FRMKTPNNNDDIDVETGKSGKDIEKAMRS-RRILT 56 ++HQL GL D+V VRRE+ SRS M TP+N D+IDVE+GK + EK +RS +R+L Sbjct: 17 KSHQLNGLPDEVSSPVRREVVSRSALGMNTPSNYDEIDVESGKLEEGREKTVRSSKRVLR 76 Query: 55 VRNPALLSGLAYCFSSCS 2 + N ALL+GLAYCFSSCS Sbjct: 77 IHNQALLAGLAYCFSSCS 94 >ref|XP_020550138.1| GDP-mannose transporter GONST1-like isoform X2 [Sesamum indicum] Length = 276 Score = 80.9 bits (198), Expect = 1e-15 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -1 Query: 172 IASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGLAYCFSSCS 2 +ASRSF +K P N+D++DVE G++ KD KA RS+R+LT+ N ALLSGLAYCFSSCS Sbjct: 1 MASRSFGVKIPGNHDEVDVEAGRTEKDRGKAFRSKRVLTIHNQALLSGLAYCFSSCS 57 >ref|XP_011080450.1| GDP-mannose transporter GONST1-like isoform X1 [Sesamum indicum] Length = 341 Score = 80.9 bits (198), Expect = 3e-15 Identities = 37/57 (64%), Positives = 47/57 (82%) Frame = -1 Query: 172 IASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSGLAYCFSSCS 2 +ASRSF +K P N+D++DVE G++ KD KA RS+R+LT+ N ALLSGLAYCFSSCS Sbjct: 1 MASRSFGVKIPGNHDEVDVEAGRTEKDRGKAFRSKRVLTIHNQALLSGLAYCFSSCS 57 >gb|PHU03127.1| GDP-mannose transporter GONST1, partial [Capsicum chinense] Length = 334 Score = 78.6 bits (192), Expect = 2e-14 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD++ RRE+ +RSF MK N ND+ D+E G S KD EK++RS + +TV N ALLSG Sbjct: 11 LLDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSG 69 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 70 VAYCISSCS 78 >ref|XP_021636726.1| GDP-mannose transporter GONST1-like isoform X1 [Hevea brasiliensis] ref|XP_021636727.1| GDP-mannose transporter GONST1-like isoform X1 [Hevea brasiliensis] ref|XP_021636728.1| GDP-mannose transporter GONST1-like isoform X1 [Hevea brasiliensis] Length = 378 Score = 78.6 bits (192), Expect = 2e-14 Identities = 40/75 (53%), Positives = 55/75 (73%), Gaps = 1/75 (1%) Frame = -1 Query: 223 HQL*GLLDQVPGLVRREIASRS-FRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRN 47 H+L G++DQ +R+EI +RS F MK+ + ND+ID+E GK KD +K RS R++ ++N Sbjct: 18 HELNGIVDQTTSPIRKEIVNRSSFAMKS-HENDEIDLEDGKLEKDRDKTARSNRVIKIQN 76 Query: 46 PALLSGLAYCFSSCS 2 ALLSGLAYC SSCS Sbjct: 77 QALLSGLAYCISSCS 91 >gb|PHT68540.1| GDP-mannose transporter GONST1, partial [Capsicum annuum] Length = 399 Score = 78.6 bits (192), Expect = 3e-14 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD++ RRE+ +RSF MK N ND+ D+E G S KD EK++RS + +TV N ALLSG Sbjct: 41 LLDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSG 99 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 100 VAYCISSCS 108 >ref|XP_016542725.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Capsicum annuum] Length = 402 Score = 78.6 bits (192), Expect = 3e-14 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD++ RRE+ +RSF MK N ND+ D+E G S KD EK++RS + +TV N ALLSG Sbjct: 44 LLDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSG 102 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 103 VAYCISSCS 111 >ref|XP_016542724.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Capsicum annuum] Length = 403 Score = 78.6 bits (192), Expect = 3e-14 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD++ RRE+ +RSF MK N ND+ D+E G S KD EK++RS + +TV N ALLSG Sbjct: 45 LLDKLSNSFRREVVNRSFSMKAANRNDE-DLENGMSEKDTEKSVRSNKAVTVHNKALLSG 103 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 104 VAYCISSCS 112 >ref|XP_016441323.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Nicotiana tabacum] Length = 401 Score = 78.2 bits (191), Expect = 3e-14 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD V RRE+ +RSF MK N ND+ D+E G KD EK++RS +++TV N ALLSG Sbjct: 45 LLDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSG 103 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 104 VAYCISSCS 112 >ref|XP_009760359.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Nicotiana sylvestris] Length = 401 Score = 78.2 bits (191), Expect = 3e-14 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD V RRE+ +RSF MK N ND+ D+E G KD EK++RS +++TV N ALLSG Sbjct: 45 LLDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSG 103 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 104 VAYCISSCS 112 >ref|XP_016441322.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Nicotiana tabacum] Length = 402 Score = 78.2 bits (191), Expect = 3e-14 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD V RRE+ +RSF MK N ND+ D+E G KD EK++RS +++TV N ALLSG Sbjct: 46 LLDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSG 104 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 105 VAYCISSCS 113 >ref|XP_009760358.1| PREDICTED: GDP-mannose transporter GONST1 isoform X1 [Nicotiana sylvestris] Length = 402 Score = 78.2 bits (191), Expect = 3e-14 Identities = 39/69 (56%), Positives = 49/69 (71%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD V RRE+ +RSF MK N ND+ D+E G KD EK++RS +++TV N ALLSG Sbjct: 46 LLDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDAEKSVRSNKVVTVHNKALLSG 104 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 105 VAYCISSCS 113 >ref|XP_009590643.1| PREDICTED: GDP-mannose transporter GONST1 isoform X2 [Nicotiana tomentosiformis] ref|XP_016480578.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X1 [Nicotiana tabacum] Length = 403 Score = 77.4 bits (189), Expect = 7e-14 Identities = 39/69 (56%), Positives = 48/69 (69%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLD V RRE+ +RSF MK N ND+ D+E G KD EK+ RS +++TV N ALLSG Sbjct: 45 LLDHVSSSFRREVVNRSFSMKAVNKNDE-DLENGMLEKDTEKSARSNKVVTVHNKALLSG 103 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 104 VAYCISSCS 112 >ref|XP_015059041.1| PREDICTED: GDP-mannose transporter GONST1-like isoform X2 [Solanum pennellii] Length = 401 Score = 77.0 bits (188), Expect = 9e-14 Identities = 40/69 (57%), Positives = 49/69 (71%) Frame = -1 Query: 208 LLDQVPGLVRREIASRSFRMKTPNNNDDIDVETGKSGKDIEKAMRSRRILTVRNPALLSG 29 LLDQV R E+ +RSF MK N ND+ D+E G KDIEK++RS + +TV N ALLSG Sbjct: 43 LLDQVSKSFRGEVVNRSFSMKAANKNDE-DLENGMLEKDIEKSVRSNKGITVHNKALLSG 101 Query: 28 LAYCFSSCS 2 +AYC SSCS Sbjct: 102 IAYCISSCS 110